NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS32082.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32082.1 Public Homo sapiens 14 GNG2 24 110 108 CCDS HistoryNCBI Gene:54331Re-query CCDS DB by CCDS ID:32082.1See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 32082.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000335281.8 ENSP00000334448.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000335281.8Link to Ensembl Protein Viewer:ENSP00000334448.4Re-query CCDS DB by Nucleotide ID:ENST00000335281Re-query CCDS DB by Protein ID:ENSP00000334448
Original member Current member EBI ENST00000555472.5 ENSP00000451102.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555472.5Link to Ensembl Protein Viewer:ENSP00000451102.1Re-query CCDS DB by Nucleotide ID:ENST00000555472Re-query CCDS DB by Protein ID:ENSP00000451102
Original member Current member EBI ENST00000556766.6 ENSP00000451231.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000556766.6Link to Ensembl Protein Viewer:ENSP00000451231.1Re-query CCDS DB by Nucleotide ID:ENST00000556766Re-query CCDS DB by Protein ID:ENSP00000451231
Original member Current member EBI ENST00000556752.2 ENSP00000451576.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000556752.2Link to Ensembl Protein Viewer:ENSP00000451576.1Re-query CCDS DB by Nucleotide ID:ENST00000556752Re-query CCDS DB by Protein ID:ENSP00000451576
Original member Current member EBI ENST00000554736.5 ENSP00000452014.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554736.5Link to Ensembl Protein Viewer:ENSP00000452014.1Re-query CCDS DB by Nucleotide ID:ENST00000554736Re-query CCDS DB by Protein ID:ENSP00000452014
Original member Current member EBI ENST00000615906.4 ENSP00000484021.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000615906.4Link to Ensembl Protein Viewer:ENSP00000484021.1Re-query CCDS DB by Nucleotide ID:ENST00000615906Re-query CCDS DB by Protein ID:ENSP00000484021
Original member Current member NCBI NM_001243773.2 NP_001230702.1 Accepted alive Link to Nucleotide Sequence:NM_001243773.2Link to Protein Sequence:NP_001230702.1Re-query CCDS DB by Nucleotide ID:NM_001243773Re-query CCDS DB by Protein ID:NP_001230702Link to BLAST:NP_001230702.1
Original member Current member NCBI NM_001243774.2 NP_001230703.1 Accepted alive Link to Nucleotide Sequence:NM_001243774.2Link to Protein Sequence:NP_001230703.1Re-query CCDS DB by Nucleotide ID:NM_001243774Re-query CCDS DB by Protein ID:NP_001230703Link to BLAST:NP_001230703.1
Original member Current member NCBI NM_001389707.1 NP_001376636.1 Accepted alive Link to Nucleotide Sequence:NM_001389707.1Link to Protein Sequence:NP_001376636.1Re-query CCDS DB by Nucleotide ID:NM_001389707Re-query CCDS DB by Protein ID:NP_001376636Link to BLAST:NP_001376636.1
Original member Current member NCBI NM_001389708.1 NP_001376637.1 Accepted alive Link to Nucleotide Sequence:NM_001389708.1Link to Protein Sequence:NP_001376637.1Re-query CCDS DB by Nucleotide ID:NM_001389708Re-query CCDS DB by Protein ID:NP_001376637Link to BLAST:NP_001376637.1
Original member Current member NCBI NM_001389709.1 NP_001376638.1 Accepted alive Link to Nucleotide Sequence:NM_001389709.1Link to Protein Sequence:NP_001376638.1Re-query CCDS DB by Nucleotide ID:NM_001389709Re-query CCDS DB by Protein ID:NP_001376638Link to BLAST:NP_001376638.1
Original member Current member NCBI NM_001389710.1 NP_001376639.1 Accepted alive Link to Nucleotide Sequence:NM_001389710.1Link to Protein Sequence:NP_001376639.1Re-query CCDS DB by Nucleotide ID:NM_001389710Re-query CCDS DB by Protein ID:NP_001376639Link to BLAST:NP_001376639.1
Original member Current member NCBI NM_053064.5 NP_444292.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_053064.5Link to Protein Sequence:NP_444292.1Re-query CCDS DB by Nucleotide ID:NM_053064Re-query CCDS DB by Protein ID:NP_444292Link to BLAST:NP_444292.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001230702.1 71 P59768 71 100% 0 0
NP_001230703.1 71 P59768 71 100% 0 0
NP_001376636.1 71 P59768 71 100% 0 0
NP_001376637.1 71 P59768 71 100% 0 0
NP_001376638.1 71 P59768 71 100% 0 0
NP_001376639.1 71 P59768 71 100% 0 0
NP_444292.1 71 P59768 71 100% 0 0

Chromosomal Locations for CCDS 32082.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 51950679 51950765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 51966559 51966687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (216 nt):
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAGATGGAAGCCA
ATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTACTGTGAAGCACATGCCAAGGA
AGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCGTTTAGGGAGAAGAAGTTTTTCTGTGCCATC
CTTTAA

Translation (71 aa):
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAI
L


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH