NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS38686.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38686.1 Public Mus musculus 4 Chchd7 23 108 98 CCDS HistoryNCBI Gene:66433Re-query CCDS DB by CCDS ID:38686.1Re-query CCDS DB by GeneID:66433See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38686.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000041122.10 ENSMUSP00000041196.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041122.10Link to Ensembl Protein Viewer:ENSMUSP00000041196.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000041122Re-query CCDS DB by Protein ID:ENSMUSP00000041196
Original member Current member EBI ENSMUST00000108386.7 ENSMUSP00000104023.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000108386.7Link to Ensembl Protein Viewer:ENSMUSP00000104023.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000108386Re-query CCDS DB by Protein ID:ENSMUSP00000104023
Original member Current member EBI ENSMUST00000121651.7 ENSMUSP00000112967.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121651.7Link to Ensembl Protein Viewer:ENSMUSP00000112967.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000121651Re-query CCDS DB by Protein ID:ENSMUSP00000112967
Original member Current member EBI ENSMUST00000121110.7 ENSMUSP00000113276.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121110.7Link to Ensembl Protein Viewer:ENSMUSP00000113276.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000121110Re-query CCDS DB by Protein ID:ENSMUSP00000113276
Original member Current member EBI ENSMUST00000119403.1 ENSMUSP00000113613.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119403.1Link to Ensembl Protein Viewer:ENSMUSP00000113613.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000119403Re-query CCDS DB by Protein ID:ENSMUSP00000113613
Original member Current member EBI ENSMUST00000119307.7 ENSMUSP00000113811.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119307.7Link to Ensembl Protein Viewer:ENSMUSP00000113811.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000119307Re-query CCDS DB by Protein ID:ENSMUSP00000113811
Original member Current member EBI ENSMUST00000150618.7 ENSMUSP00000118860.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000150618.7Link to Ensembl Protein Viewer:ENSMUSP00000118860.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000150618Re-query CCDS DB by Protein ID:ENSMUSP00000118860
Original member Current member NCBI NM_001190322.2 NP_001177251.1 Accepted alive Link to Nucleotide Sequence:NM_001190322.2Link to Protein Sequence:NP_001177251.1Re-query CCDS DB by Nucleotide ID:NM_001190322Re-query CCDS DB by Protein ID:NP_001177251Link to BLAST:NP_001177251.1
Original member Current member NCBI NM_001190323.2 NP_001177252.1 Accepted alive Link to Nucleotide Sequence:NM_001190323.2Link to Protein Sequence:NP_001177252.1Re-query CCDS DB by Nucleotide ID:NM_001190323Re-query CCDS DB by Protein ID:NP_001177252Link to BLAST:NP_001177252.1
Original member Current member NCBI NM_001190324.2 NP_001177253.1 Accepted alive Link to Nucleotide Sequence:NM_001190324.2Link to Protein Sequence:NP_001177253.1Re-query CCDS DB by Nucleotide ID:NM_001190324Re-query CCDS DB by Protein ID:NP_001177253Link to BLAST:NP_001177253.1
Original member Current member NCBI NM_001285804.1 NP_001272733.1 Accepted alive Link to Nucleotide Sequence:NM_001285804.1Link to Protein Sequence:NP_001272733.1Re-query CCDS DB by Nucleotide ID:NM_001285804Re-query CCDS DB by Protein ID:NP_001272733Link to BLAST:NP_001272733.1
Original member Current member NCBI NM_181391.4 NP_852056.1 Accepted alive Link to Nucleotide Sequence:NM_181391.4Link to Protein Sequence:NP_852056.1Re-query CCDS DB by Nucleotide ID:NM_181391Re-query CCDS DB by Protein ID:NP_852056Link to BLAST:NP_852056.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001177251.1 85 Q8K2Q5 85 100% 0 0
NP_001177252.1 85 Q8K2Q5 85 100% 0 0
NP_001177253.1 85 Q8K2Q5 85 100% 0 0
NP_001272733.1 85 Q8K2Q5 85 100% 0 0
NP_852056.1 85 Q8K2Q5 85 100% 0 0

Chromosomal Locations for CCDS 38686.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 3941258 3941311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 3942721 3942819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 3943388 3943492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (258 nt):
ATGCCCATGGTCACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCGGAATCTGATGCTTCTA
CCAGATGCATGGATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTG
CCGGCGATTCTGGAATTCTGTCATGATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTACAGCA
GCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGA

Translation (85 aa):
MPMVTRRLRDPDINPCLSESDASTRCMDENNYDRERCSSYFLKYKNCRRFWNSVMIQRRQNGVQPSMPTA
AERDEILGAMQKMPY


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH