NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS52701.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52701.2 Reviewed, update pending Mus musculus 8 Dbndd1 23 108 98 CCDS HistoryNCBI Gene:72185Re-query CCDS DB by CCDS ID:52701.2Re-query CCDS DB by GeneID:72185See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 52701.1
The coding region has been updated to shorten the N-terminus to one that is more supported by the available transcript and conservation data. It should be noted that this gene has three possible start codons, where the update represents the second one. The first start codon appears to be restricted to mouse and rat, and only one mouse and one rat mRNA (AK163434.1 and BC088277.1, respectively) extend far enough 5' to include it. Furthermore, the first start codon occurs very close to the 5' end of these mRNAs, and thus, assuming a transcription start site at or very close to this end, the ribosome may not be able to use the first start codon. The second start codon also appears rodent-specific because other species have subsequent frameshifting indels. This has a weak Kozak signal, so it is possible that ribosomal leaky scanning may sometimes allow the third possible start codon to be used in rodents. The third start codon is best conserved and is used by non-rodent species. There is no experimental evidence indicating which start codon is preferentially used in mouse.

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 52701.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000176286.7 ENSMUSP00000134757.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000176286.7Link to Ensembl Protein Viewer:ENSMUSP00000134757.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000176286Re-query CCDS DB by Protein ID:ENSMUSP00000134757
Original member NCBI NM_001170976.1 NP_001164447.2 Updated not alive Link to Nucleotide Sequence:NM_001170976.1Link to Protein Sequence:NP_001164447.2Re-query CCDS DB by Nucleotide ID:NM_001170976Re-query CCDS DB by Protein ID:NP_001164447
Current member NCBI NM_001170976.2 NP_001164447.3 Pending alive Link to Nucleotide Sequence:NM_001170976.2Link to Protein Sequence:NP_001164447.3Re-query CCDS DB by Nucleotide ID:NM_001170976Re-query CCDS DB by Protein ID:NP_001164447Link to BLAST:NP_001164447.3

Chromosomal Locations for CCDS 52701.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123505681 123505685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123509842 123509994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123515233 123515365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (291 nt):
ATGCGCTGTGCCCGAAGCCCGGACTCAGTAGTCACCAGAGCAGTTGGGGCACCCGGGCTGTCGCCGCCGC
TGCCCACACCCCCCGCGGACCCCATTGGCCGCATGGAGTCTCCCGAGGGCGCTGGTCCGGGAGAGATCGT
TAAGGACGTCAAGGTACCACAGGCTGCCCTGAATGTTTCAGCTCATGAGACAGGGGACATGTGCCGTACA
CCTGTGGCAGAGGAGGAGGAGGAGGTTGGCATCCCAATACCAGCACCAGGGTTCCTGCAGGTCACAGAGA
GGAGGCGTTGA

Translation (96 aa):
MRCARSPDSVVTRAVGAPGLSPPLPTPPADPIGRMESPEGAGPGEIVKDVKVPQAALNVSAHETGDMCRT
PVAEEEEEVGIPIPAPGFLQVTERRR


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH