NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS10076.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10076.1 Public Homo sapiens 15 ITPKA 22 109 92 CCDS HistoryNCBI Gene:3706Re-query CCDS DB by CCDS ID:10076.1Re-query CCDS DB by GeneID:3706See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10076.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000260386.6 ENSP00000260386.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260386.6Link to Ensembl Protein Viewer:ENSP00000260386.5Re-query CCDS DB by Nucleotide ID:ENST00000260386Re-query CCDS DB by Protein ID:ENSP00000260386
Original member NCBI NM_002220.2 NP_002211.1 Updated not alive Link to Nucleotide Sequence:NM_002220.2Link to Protein Sequence:NP_002211.1Re-query CCDS DB by Nucleotide ID:NM_002220Re-query CCDS DB by Protein ID:NP_002211
Current member NCBI NM_002220.3 NP_002211.1 Accepted alive Link to Nucleotide Sequence:NM_002220.3Link to Protein Sequence:NP_002211.1Re-query CCDS DB by Nucleotide ID:NM_002220Re-query CCDS DB by Protein ID:NP_002211Link to BLAST:NP_002211.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002211.1 461 P23677 461 100% 0 0

Chromosomal Locations for CCDS 10076.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 41493928 41494416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41501463 41501559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41501635 41501851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41501997 41502201 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41502402 41502503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41502788 41502859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41502963 41503166 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1386 nt):
ATGACCCTGCCCGGGGGCCCAACGGGCATGGCGCGGCCGGGGGGCGCGAGGCCCTGCAGCCCGGGGCTGG
AG
CGGGCCCCGCGCCGGAGTGTCGGGGAGCTGCGCCTGCTCTTCGAGGCGCGCTGTGCGGCGGTCGCTGC
G
GCCGCCGCCGCGGGGGAGCCCCGGGCCCGCGGGGCCAAGCGGCGTGGGGGACAGGTCCCCAACGGGCTT
CCG
CGGGCTCCCCCGGCCCCGGTGATCCCTCAGCTGACCGTGACAGCCGAGGAGCCCGACGTGCCCCCGA
CC
AGCCCTGGGCCGCCGGAGCGGGAGAGGGACTGCCTCCCGGCAGCGGGCTCTTCGCACCTGCAGCAGCC
G
CGCCGCCTTTCCACCTCGTCGGTCTCCTCCACTGGCTCCTCGTCGCTGCTCGAGGACTCGGAGGACGAC
CTG
CTGAGCGACAGTGAGAGCCGGAGCCGCGGCAACGTGCAGCTGGAAGCGGGCGAGGACGTGGGTCAGA
AA
AACCACTGGCAGAAGATCCGGACCATGGTCAATCTGCCGGTCATAAGCCCTTTCAAGAAGCGCTACGC
C
TGGGTGCAGCTGGCAGGGCACACTGGGAGTTTTAAGGCGGCGGGCACCAGCGGGCTGATCCTGAAGCGC
TGC
TCGGAGCCGGAGCGCTACTGCCTGGCGCGGCTGATGGCTGACGCGCTGCGCGGCTGCGTGCCTGCCT
TC
CACGGCGTGGTGGAGCGCGACGGCGAAAGCTACCTGCAGCTGCAGGACCTGCTCGATGGCTTCGACGG
A
CCTTGTGTGCTCGACTGCAAAATGGGCGTCAGGACTTACCTAGAGGAGGAGCTGACCAAGGCCCGTGAG
CGG
CCCAAGCTGCGGAAGGACATGTACAAGAAAATGCTGGCGGTGGATCCTGAAGCTCCCACGGAGGAGG
AG
CACGCGCAGCGCGCCGTCACCAAGCCGCGCTACATGCAGTGGCGGGAAGGCATCAGCTCCAGCACCAC
C
CTCGGCTTCCGCATCGAGGGCATCAAGAAAGCGGACGGCTCCTGCAGCACCGACTTCAAGACTACGCGA
AGC
CGAGAGCAGGTGCTTCGCGTCTTTGAAGAGTTTGTGCAAGGAGATGAGGAAGTGCTGAGGCGGTATC
TG
AACCGCCTGCAGCAGATCCGGGACACCCTGGAGGTATCCGAGTTCTTCAGGAGGCACGAGGTGATCGG
C
AGCTCGCTCCTCTTTGTGCACGATCACTGCCATCGCGCCGGCGTGTGGCTCATCGACTTCGGCAAGACC
ACG
CCCCTCCCCGATGGCCAGATCCTGGACCACCGGCGGCCCTGGGAGGAGGGCAACCGCGAGGACGGCT
AT
TTGCTGGGGCTGGACAATCTCATTGGCATCCTGGCCAGCCTGGCTGAGAGATGA


Translation (461 aa):
MTLPGGPTGMARPGGARPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAKRRGGQVPNGL
P
RAPPAPVIPQLTVTAEEPDVPPTSPGPPERERDCLPAAGSSHLQQPRRLSTSSVSSTGSSSLLEDSEDD
L
LSDSESRSRGNVQLEAGEDVGQ
KNHWQKIRTMVNLPVISPFKKRYAWVQLAGHTGSFKAAGTSGLILKR
C
SEPERYCLARLMADALRGCVPAFHGVVERDGESYLQLQDLLDGFDGPCVLDCKMGV
RTYLEEELTKARE
R
PKLRKDMYKKMLAVDPEAPTEEEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIK
KADGSCSTDFKTTR
S
REQVLRVFEEFVQGDEEVL
RRYLNRLQQIRDTLEVSEFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKT
T
PLPDGQILDHRRPWEEGNREDGYLLGLDNLIGILASLAER




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser