NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15655.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15655.1 Public Mus musculus 2 Fam107b 23 108 98 CCDS HistoryNCBI Gene:66540Re-query CCDS DB by CCDS ID:15655.1Re-query CCDS DB by GeneID:66540See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 15655.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000027965.10 ENSMUSP00000027965.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027965.10Link to Ensembl Protein Viewer:ENSMUSP00000027965.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000027965Re-query CCDS DB by Protein ID:ENSMUSP00000027965
Original member Current member EBI ENSMUST00000115053.8 ENSMUSP00000110705.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115053.8Link to Ensembl Protein Viewer:ENSMUSP00000110705.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115053Re-query CCDS DB by Protein ID:ENSMUSP00000110705
Original member Current member EBI ENSMUST00000115054.8 ENSMUSP00000110706.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115054.8Link to Ensembl Protein Viewer:ENSMUSP00000110706.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115054Re-query CCDS DB by Protein ID:ENSMUSP00000110706
Original member Current member EBI ENSMUST00000115055.8 ENSMUSP00000110707.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115055.8Link to Ensembl Protein Viewer:ENSMUSP00000110707.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000115055Re-query CCDS DB by Protein ID:ENSMUSP00000110707
Original member Current member NCBI NM_025626.4 NP_079902.1 Accepted alive Link to Nucleotide Sequence:NM_025626.4Link to Protein Sequence:NP_079902.1Re-query CCDS DB by Nucleotide ID:NM_025626Re-query CCDS DB by Protein ID:NP_079902Link to BLAST:NP_079902.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079902.1 131 Q3TGF2 131 100% 0 0

Chromosomal Locations for CCDS 15655.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 3772852 3772979 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 3778418 3778568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 3779501 3779617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (396 nt):
ATGGCTGAGCCAGACTACATAGAAGATGACAATCCTGAGCTAATTAGGCCCCAGAAGCTTATCAACCCTG
TC
AAAAGCTCCCGAAATCACCAAGACCTCCACAGAGAGCTTCTTATGAATCAGAAAAGAGGTCTTGCCCC
T
CAGAATAAACCAGAACTGCAGAAGGTGATGGAGAAGAGAAGACGAGACCAAGTGATAAAGCAGAAGGAG
GAA
GAAGCTCAGAAGAAGAAATCCGACCTGGAAATAGAACTATTAAAGCGACAGCAGAAGCTGGAGCAGC
TT
GAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCAGAGTTTGTGAAGGTGAAAGGCAA
T
CTCAGGAGAACAGGCCAAGAGGTGGCTCAGGCCCAGGAGTCCTAG


Translation (131 aa):
MAEPDYIEDDNPELIRPQKLINPVKSSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRRRDQVIKQKE
E
EAQKKKSDLEIELLKRQQKLEQ
LELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser