NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15908.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15908.1 Public Mus musculus 2 Pomt1 23 108 98 CCDS HistoryNCBI Gene:99011Re-query CCDS DB by CCDS ID:15908.1Re-query CCDS DB by GeneID:99011See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15908.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000036473.15 ENSMUSP00000038722.9 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036473.15Link to Ensembl Protein Viewer:ENSMUSP00000038722.9Re-query CCDS DB by Nucleotide ID:ENSMUST00000036473Re-query CCDS DB by Protein ID:ENSMUSP00000038722
Original member Current member NCBI NM_145145.2 NP_660127.1 Accepted alive Link to Nucleotide Sequence:NM_145145.2Link to Protein Sequence:NP_660127.1Re-query CCDS DB by Nucleotide ID:NM_145145Re-query CCDS DB by Protein ID:NP_660127Link to BLAST:NP_660127.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_660127.1 746 Q8R2R1 746 100% 0 0

Chromosomal Locations for CCDS 15908.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 32236706 32236741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32237360 32237511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32240427 32240533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32240665 32240715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32241653 32241799 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32242893 32243004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32243465 32243530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32243619 32243712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32244234 32244389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32245547 32245677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32246015 32246110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32247537 32247629 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32248615 32248711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32250470 32250562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32250789 32250909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32251262 32251359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32251910 32252023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32252876 32253002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32253716 32253893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 32254273 32254444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2241 nt):
ATGGGGAGCCACTCTACGGGACTCGAAGAAACGCTCGGAGTCCTCCCGAGCTGGCTTTTCTGCAAAATGT
TA
AGATTTTTGAAACGGCCTCTAGTGGTGACTGTTGACATCAATTTGAACTTGGTAGCTCTGACTGGCCT
G
GGACTACTTACCCGACTATGGCAACTCTCCTACCCTCGGGCTGTGGTTTTCGATGAAGTATATTATGGG
CAG
TACATTTCCTTCTACATGAAGCGCATCTTCTTTCTGGATGACAGTGGGCCACCATTTGGCCACATGC
TA
CTGGCCTTAGGAGGTTGGTTAGGGGGATTCGATGGTAACTTTCTGTGGAACCGAATTGGAGCAGAGTA
C
AGTAGCAATGTGCCTATATGGTCCTTACGCCTGCTGCCAGCGCTTGCCGGGGCCCTGTCAGTGCCCATG
GCC
TACCAGATAGTGCTAGAGCTCCACTTTTCCCACGGTGCTGCCATTGGAGCCGCCCTGCTGATGCTCA
TT
GAGAACGCCCTGATCACTCAGTCCAGGCTCATGCTGTTGGAGTCCATACTGATATTTTTTAACCTGTT
G
GCTGTGTTGTCCTATCTGAAGTTCTTCAACTCCCAGACACACAGCCCTTTCTCAGTGCACTGGTGGCTG
TGG
CTACTGCTGACCGGGGTCTCTTGTTCCTGTGCAGTTGGGATCAAATACATGGGGATTTTCACCTACC
TG
CTTGTGCTCGGCATTGCAGCTGTCCACGCGTGGAATCTGATCGGAGACCAGACCTTGTCAAATATGCG
C
GTGCTCAGTCACTTGCTCGCCAGAATCGTGGCTCTGCTGGTCGTCCCAGTCTTCCTGTACTTACTCTTC
TTC
TATGTCCACCTGATGCTGCTCTACCGCTCTGGGCCCCATGACCAAATCATGTCCAGTGCCTTCCAGG
CC
AGCTTGGAGGGAGGGCTTGCCCGCATCACCCAAGGCCAGCCCCTGGAGGTGGCCTTTGGTTCCCAGGT
C
ACTCTGAAGAGCGTCTCTGGCAAACCCTTGCCCTGCTGGCTTCATTCGCACAAGAACACCTATCCCATG
AT
A
TATGAGAATGGCCGTGGCAGCTCCCACCAGCAACAGGTGACCTGTTATCCCTTCAAAGACATCAATA
AC
TGGTGGATCGTCAAGGATCCTGGGCGACACCAGCTGGTGGTAAACAACCCTCCCCGGCCTGTAAGACA
T
GGAGACATTGTACAGCTCGTTCACGGCATGACCACCCGCCTCCTTAACACGCACGATGTCGCAGCCCCA
CTG
AGCCCCCATTCTCAAGAAGTCTCCTGCTACATTGACTATAACATCTCCATGCCTGCCCAGAACCTCT
GG
AAACTGGACATTGTGAACAGAGAGTCCAACCGGGATACCTGGAAGACTATCTTGTCGGAAGTGCGCTT
T
GTACATGTGAACACATCCGCCATCTTGAAGCTGAGCGGGGCTCACCTCCCTGACTGGGGGTTCCGGCAG
TTG
GAGGTAGTTGGGGAGAAGTTGTCACCGGGCTACCACGAGAGCATGGTGTGGAATGTGGAAGAACACC
GG
TATGGCAAAAGCCATGAGCAGAAGGAGAGGGAGCTGGAGCTCCACTCGCCCACTCAGCTCGATATCAG
C
AGGAACCTCAGCTTCATGGCCAGATTCTCAGAGTTACAGTGGAAGATGCTGACGCTGAAGAATGAGGAC
TTG
GAACACCAGTACAGCTCCACCCCGCTGGAGTGGCTCACGCTGGACACCAACATCGCCTATTGGCTAC
AT
CCCAGGACCAGTGCTCAGATCCACTTGCTTGGGAACATTGTGATCTGGACTTCAGCCAGCCTTGCCAC
A
GTGGTCTACACTCTACTCTTCTTCTGGTACCTGCTCCGCCGGCGAAGGAGCATCTGTGACCTCCCTGAG
G
AT
GCCTGGTCCCGCTGGGTGCTGGCTGGAGCCCTGTGTACTGGCGGCTGGGCACTCAACTACCTGCCCT
TC
TTCCTGATGGAGAGGGTGCTCTTCCTCTACCACTACTTGCCGGCACTCACCTTCCAGATCCTGCTGCT
C
CCGATTGTCCTGCAGCACGCCAGCGACCATCTGTGCAGGTCCCAGCTGCAGAGGAATGTCTTCAGTGCC
CTG
GTTGTAGCATGGTATTCCTCCGCATGCCATGTGTCCAACATGCTACGCCCACTAACCTATGGGGACA
CG
TCACTCTCACCAGGCGAGCTCCGGGCCCTTCGCTGGAAAGACAGCTGGGATATTCTGATCCGAAAGTA
A


Translation (746 aa):
MGSHSTGLEETLGVLPSWLFCKMLRFLKRPLVVTVDINLNLVALTGLGLLTRLWQLSYPRAVVFDEVYYG
Q
YISFYMKRIFFLDDSGPPFGHMLLALG
GWLGGFDGNFLWNRIGAEYSSNVPIWSLRLLPALAGALSVPM
A
YQIVLELHFSHGAAIGAALLMLI
ENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWL
W
LLLTGVSCSCAV
GIKYMGIFTYLLVLGIAAVHAWNLIGDQTLSNMRVLSHLLARIVALLVVPVFLYLLF
F
YVHLMLLYRSGPHDQIMSSAFQASLE
GGLARITQGQPLEVAFGSQVTLKSVSGKPLPCWLHSHKNTYPM
I
YENGRGSSHQQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAP
L
SPHSQEVSCYIDYNISMPAQNLWKL
DIVNRESNRDTWKTILSEVRFVHVNTSAILKLSGAHLPDWGFRQ
L
EVVGEKLSPGYHESMVWNVEEHRYGK
SHEQKERELELHSPTQLDISRNLSFMARFSELQWKMLTLKNED
L
EHQYSSTPLEWLTLDTNIAYWLHPRTS
AQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPE
D
AWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCRSQLQRNVFSA
L
VVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDILIRK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser