NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS16081.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16081.1 Public Mus musculus 2 Scn7a 23 108 98 CCDS HistoryNCBI Gene:20272Re-query CCDS DB by CCDS ID:16081.1Re-query CCDS DB by GeneID:20272See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16081.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000042792.6 ENSMUSP00000042405.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042792.6Link to Ensembl Protein Viewer:ENSMUSP00000042405.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000042792Re-query CCDS DB by Protein ID:ENSMUSP00000042405
Original member Current member NCBI NM_009135.2 NP_033161.2 Accepted alive Link to Nucleotide Sequence:NM_009135.2Link to Protein Sequence:NP_033161.2Re-query CCDS DB by Nucleotide ID:NM_009135Re-query CCDS DB by Protein ID:NP_033161Link to BLAST:NP_033161.2

Chromosomal Locations for CCDS 16081.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 66675498 66676561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66680075 66680345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66680864 66680968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66682705 66682842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66683267 66683320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66684015 66684293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66687731 66687838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66689532 66689705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66692506 66692660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66694810 66694915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66697553 66697987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66699843 66700199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66700732 66700902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66703701 66703939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66705016 66705112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66713853 66714059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66726154 66726295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66729012 66729081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66737375 66737581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66741959 66742050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66743703 66743831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66751870 66751959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66752196 66752314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 66757121 66757357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5046 nt):
ATGTTGACTTCCCCAGAGCCGAAGGGCCTTGTCCCATTTACAACAGAGTCACTTGAACTTATAGAAAATC
AC
ATTGCTAAAAAATGCAATGAAGACCCCGAAGAAGAAGAAGGTTTAAAACCAAGTCGTAATCTAGAAGC
T
GGCAAAAGACTTCCAATTCCCTATGGAACCCTCCCTCGAGGAACCGTGTCAGAGCCCTTGGAAGATGTG
GAT
CCATACTACTATGTTAAGAGAAATACTTTCATGGTCTTAAACAGAAGCAGAGTCATCTTCAGGTTCA
AT
GCGGTTTCCATCTTCTGCACATTGTCTCCTCTAAACTCCCTCAGAAGAGCAGCTATCAAGGCTTTGGT
G
CATCCCCTTTTTCGCCTGCTGATTTTAATCAGCGTTCTCACTGACAGCATACTTATGTGCATGAGTAAT
CTA
CCAGAATGGATATTGGCAATAGAGAATACTTTGCTTGGGATTTACGCATTTGAAATACTTGTAAAAG
TC
ATTGCAAGAGGTATCTGGGCAGGTTCATTTTCCTTCCTTGGGGATCTTTGGAACTGGCTTGATTTCAG
T
GTAACTTTGTTCGAGCTAATCACAAGGTTTTCACCTCTAAGCTCCTTTTTAATGCTTAAAACTATCAGA
ACT
TTCCGAATTTTGAAGATTATCCCTTTGAACCACGGCCTGCAGTCTATTGTGATGACACTGGCCCAGT
GT
TTGAAGAAACTATTTGGTGCCATTGCCCTAGCTCTGTTTTTTCTGGCTGTGTTTTCACTACTTGGAAT
G
GGCCTCTTCATGGGCAACCTGAAGCACAAATGTCTGCGGTGGCCAGAAGAAAATGAAAATGAAACGCTG
CAC
AACAGAACTGGAAGCCTTAACTATAGTCCAGAAAGAATAAACTTCTACTACATGGAAGGAGCGAAAT
AT
GCTCTCCTTTGCGGCAACAGGACAGATGCTGGCCAGTGTCCGGAAGGTTATGTGTGTGTAAAAGAAGG
C
ACAAATCCTGACAATGGCTTCACAAGTTTTGACAACTTTGGCTGGTCCCTTCTTGCTATGTTTCGATTG
ATG
ACACAGGATTACCCTGAATTACTTTATCACCAGATCCTTTATGCTTCAGGAAAGGTCTACATGATAT
TT
TTTGTTATGATCAGTTTCTGGTTTGCCTTCTATTTGACAAGTTTGTTCTTGGGCATACTCACTATGAC
C
TATGAAAAGGAAAAGCAGAGAGCCTGTGAGGAATCTGGAGGCCTTGATCCCAAATGTCAACAGACAGTG
AAA
GAACTCGACGAAGAAAATGACGCAGCTGAGATGGAAACTACACAAATAGAAATGAAGAAAAGATCCC
CA
ACTTCTATAAACACCACACTGGATATACTGGAAGACACTACCCTCGGACACAGAGAAGAACCAGAAAC
A
TCCAGGAAGAAATGCCCAATATGTTGGCATAAGTTTATTAAAACCTGCTTCATCTGGAAATGCTCTCCC
TGT
TGGGTAAAACTGAACGAGTTTGCTGATAGAGTTATAACACACCCATTGGCTGATCTTTTTCTTGTCA
TC
TGCATCGTTTTAAACATATGCTTCCTCGCCCTAGAACATTTTCCAATGAGCGAGGAGCTCAGGTCTCT
C
CTTCACGTTGGAAATTTGGTTTTTATTGGAATTTACACAATAGAAATGATTTTGAAGATAATCGCTATG
CAT
CCATATGGGTATTTTCAAATAAGCTGGAATATTTTTGACAGTATACTTGTGGTTTTGGAGTTAACAG
AA
ATTTTACTAGCAGATGTTGAAGGACTAGCTGTTTTAATAACAGTCCCATTGATATTTATAAAACTGGG
G
AAGTACGGACCACCATTTAAGAGTTTGATGCGCATCCTTGGTAGCTCATTGATGGCCCTGAAAGATTTG
GTC
CTGTTGCTCTGCATATTCGTTTACTTCTCTGCTGTGTTCGGCATGAAGCTGTTTGGTCGAAGTTACA
AG
GATTGTGTCTGCCACATAAAGGAAGACTGCCAACCCCAACGCTGGCACATGAGTGACTTCCTTCATGC
C
TACATGACCGTGTTCCGAATCCTCTGTGGAGAGTGGATAGAGACATTATGGGAGTGTATGGAGGTTGCA
GGC
CAGGCCTGGTGTATTCCTTTTTACATGATGGTCATTTTAATTGGAAACTTATTGATACTTTACCTCT
TT
GTGACATTGGTGAGCTCTTTCAGTTACTATGATGCTACATCGGAAGTGAACAAAGAAGCCAAAAACCT
T
CAGCTTGCCATGGCAAGGATAAAGTCGGGAATAAACTCCATGCTTCTTAAATTAATGTGCACAGAAAGA
AGT
GTTCCTACAGAAGCAACAGACCAAATATGTGATCCAAGTGTTAAAGAGAATATTTCTGGCCATACTC
TT
TCTGAACTGAGCAACACCCAAACTTTCCTCAGATATAAGGACCAGAGCAGCAGCACTGAGAAAACTCC
A
GTGACTGAATCTGAGAGTCAATCTCTGATTGCTAGTCCCAGTGCCTCTGAAACTGTGCCGATTGCTTCA
GGA
GAATCTGATATAGAAAATCTGGATAACAAGGAGACTCGGAGCAAGTCTGGGAATGGAGGCAGTAAAG
AG
AAAATGAAGCAGTCTAGCTCATCTGAGTGCAGCACAGTTGATATCGCTATTTCTGAAGAAGAAGAAAT
G
GTCTATGAACATGAAAAGTCAAAGCTTCATAAAAATGGTTATGAACGCAAATCTTCAACTGGTCAAATC
AGT
AGAGAATCTAGGAATGGAAAGATTTGGAAAAACATCAGGAAAACTTGCTGCAAGATAGTAGAGAACA
GC
TGGTTTGAGTGTTTCATTGGCCTGGTCACTCTGCTCTGCACAGGCACTCTGGCTCTTGAAGACATATA
T
ATTGATCAGAGAAAAACCACTAAAATCTTACTGGAATATGCGGACATGATATTTGCATACATCTTCATT
CTG
GAGATGCTTCTCAAGTGGGTGGCTTATGGCTTTAAAGCCTTTTTCTCCAACAACTGGTACAAACTGG
AC
TTTATGGTTGTTATCGTGTTTTGTCTTAGCTTAATAGGCAAAACTCGAGAAGATCTGAACCCTCTGAC
A
TCAATAAAGTTCCTTCGAGCACTAAGAGTTCTGTCGCAGTTTGAAAGAATGAAGGTGGTCCTGAGAGCT
TTG
ATAAAAACAACCTTACCCACTGTGAGCGTGTTTCTAGTCTGCCTAATGATCTGGCTGCTTTTCAGTG
TT
ATTGGAGTGCAGTTATTTGCTGGCAAGTTCTATGAATGCATTGACCCAACAAAGGGAGAAAGATTCCC
T
GTATTTGAAGTTATGAATAAAAGTCAGTGTGAAAAACTGTTATTCAATGAATCAATGCCGTGGGAGAAT
GCA
AAACTGAACTTTGATAATGTTGGAAATGGTTTTCTTTCTTTACTCCAAGTGGCAACATTTAATGGAT
GG
ATCAGTATTATGAATTCAGCAATTGATTCTGTTGGTGTAAACATGCAGCCCAGCTTTGAGTACAACCT
C
TACATGTATAGTTACTTTATCATCTTTGTTATCTTTGGATTATTTCTTCCTCTCTGTATGCTGATTGGT
GTT
ATTATTCGCAATTTCAACAAGCAGAAAATTAAGCAGGGAGGATCAAACATCTTTATAACAGTAAAAC
AG
AAAAAACAGTACCGGGCCCTGAAGAAGCTCTTGTATGCAGACGTCCAGAAACCAACACCCCGCCCCAG
A
AACAAATTCCAAGGCTTCCTTTTTGACCTAGTAACACACCGTGTCTTTAATGTTATCATCATACTTCTT
ATC
TGTTTCCAAGCAACAACCATTATGATACAAAAGGATGAGCAGAGTCCACAAATGGAAACTGCCATCT
TC
TGGATGAACTCCATTTTTGTCATGCTGTTCACTCTGGAATGCATACTGAAGCTCACTGCCTTCCGTTG
C
CACTACTTCACCAGTGCATGGAATGTTCATGACTTTATGGTGGTCATTTTCTCCATTACAGGGCTGCTG
CTA
CCCTTGACAATAGGACAATACTTTGTGCCTCCTTCCCTGGTGCAGCTGATTCTTCTCTCTCGAGTCA
TC
CACATCCTGCGTCCTGGGAAAGGACCGAAGGTGTTCCATGACCTGATGCTTCCCTTGATTCTGGCGCT
C
CCAGCATTGCTGAACATTAGTCTTCTCATCTTCCTGGTCATGTTCATCTACGCCATCTTTGGAATGTAC
AAC
TTTGCCTATGTAAAGAAAGAAGCCGGAATTAATGATGTGTCCAACTTTGAGACCTTTGGAAGCAGTA
TG
CTCTGTCTCTTCCAAGTTACAACGTTTTCTGGTTGGGACGGGATGCTGGATGCAATTTTCAACAGTCA
G
TGGTCTGACTGCGATCCTGATAAAATTAATCCAGGGACTCAGGTCAAGGGAGATTGTGGGAGCCCTTCT
GTT
GGGATTTCTTATTTTGTCAGTTACATCCTCATATCATGGTTGATCATTGTTAACATGTACATTGTGT
TG
ATCATGGAGTTCTTAAGTATTCCTTCTCAGAAAAAAAGCAGGACCTTGAGTGAAGATGACTTTAGGAG
A
TTCTTCCGGGTGTGGAACAGGTTTGACCCTGATAGGACCCAGTACATAGACTCTAGCAAGCTTTCTGAT
TTT
GCAGCTGCTCTGGATCCTCCTCTTTTCATGGCAAAACCAAACAAGGGCCAGCTTGTGGCCATGGATC
TC
CCCATGGCTGCGGGAGACAGAATCCACTGCCTCGACATTTTACTTGCCTTTACGAAAAGAGTGATGGG
A
AAGGATGAGAGGGTGGAGAAAATCCTTTCAGAGATAGAATCCGGGTTCATGTTAGCGAACCCTTTCAAA
ATC
ACTTATGAGCCGATTACAACTACTTTGAAACGCAAACAAGAGGCAGTTTCAGCAACCATCATCCAGC
GT
GCATATAAAAGCTACCGCTTAAGGCAAAATGACAAGAATGTATCAGATACTCCTGCTATAGATGACCG
C
AGAGATGATCTTACTTCTAAAGGTGCTCACTCTGGCAAAATCGAGGAGAAGGCATCTATTCAGACCCAG
ATT
TAA


Translation (1681 aa):
MLTSPEPKGLVPFTTESLELIENHIAKKCNEDPEEEEGLKPSRNLEAGKRLPIPYGTLPRGTVSEPLEDV
D
PYYYVKRN
TFMVLNRSRVIFRFNAVSIFCTLSPLNSLRRAAIKALVHPLFRLLILISVLTDSILMCMSN
L
PEWILAI
ENTLLGIYAFEILVKVIARGIWAGSFSFLGDLWNWLDFSVTLFELITRFSPLSSFLMLKTIR
T
FRILKIIPLNH
GLQSIVMTLAQCLKKLFGAIALALFFLAVFSLLGMGLFMGNLKHKCLRWPEENENETL
H
NRTGSLNYSP
ERINFYYMEGAKYALLCGNRTDAGQCPEGYVCVKEGTNPDNGFTSFDNFGWSLLAMFRL
M
TQDYPELLYHQ
ILYASGKVYMIFFVMISFWFAFYLTSLFLGILTMTYEKEKQRACEESGGLDPKCQQTV
K
ELDEENDAAE
METTQIEMKKRSPTSINTTLDILEDTTLGHREEPETSRKKCPICWHKFIKTCFIWKCSP
C
WVKLNEFADRVITHPLADLFLVICIVLNICFLALEHFPMSEELRSLLHVGNL
VFIGIYTIEMILKIIAM
H
PYGYFQISWNIFDSILVVLELTEILLADVEGLAVLITVP
LIFIKLGKYGPPFKSLMRILGSSLMALKDL
V
LLLCIFVYFSAVFGMKLFGRSYKDCVCHIKEDCQPQRWHMSDFLHAYMTVFRILCGEWIETLWECMEVA
G
QAWCIPFYMMVILIGNLL
ILYLFVTLVSSFSYYDATSEVNKEAKNLQLAMARIKSGINSMLLKLMCTER
S
VPTEATDQICDPSVKENISGHTLSELSNTQTFLRYKDQSSSTEKTPVTESESQSLIASPSASETVPIAS
G
ESDIENLDNKETRSKSGNGGSKE
KMKQSSSSECSTVDIAISEEEEMVYEHEKSKLHKNGYERKSSTGQI
S
RESRNGKIWKNIRKTCCKIVENSWFECFIGLVTLLCTGTL
ALEDIYIDQRKTTKILLEYADMIFAYIFI
L
EMLLKWVAYGFKAFFSNNWYKLDFMVVI
VFCLSLIGKTREDLNPLTSIKFLRALRVLSQFERMKVVLRA
L
IKTTLPTVSVFLVCLMIWLLFSVIGVQLFAGKFYECIDPTKGERFPVFEVMNKSQCEKLLFNESMPWEN
A
KLNFDNVGNGFLSLLQV
ATFNGWISIMNSAIDSVGVNMQPSFEYNLYMYSYFIIFVIFGLFLPLCMLIG
V
IIRNFNKQKIK
QGGSNIFITVKQKKQYRALKKLLYADVQKPTPRPRNKFQGFLFDLVTHRVFNVIIILL
I
CFQATTIMIQKDEQSPQMETAIFWMNSIFVMLFTLECILKLTAFRCHYFTSAWNVHDFMVVIFSIT
GLL
L
PLTIGQYFVPPSLVQLILLSRVIHILRPGKGPKVFHDLMLPLILALPALLNISLLIFLVMFIYAIFGMY
N
FAYVKKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLDAIFNSQWSDCDPDKINPGTQVKGDCGSPS
V
GISYFVSYILISWLIIVNMYIVLIMEFLSIPSQKKSRTLSEDDFRRFFRVWNRFDPDRTQYIDSSKLSD
F
AAALDPPLFMAKPNKGQLVAMDLPMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEIESGFMLANPFK
I
TYEPITTTLKRKQEAVSATIIQRAYKSYRLRQNDKNVSDTPAIDDRRDDLTSKGAHSGKIEEKASIQTQ
I




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser