NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17468.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17468.1 Public Mus musculus 3 Cct3 23 108 98 CCDS HistoryNCBI Gene:12462Re-query CCDS DB by CCDS ID:17468.1Re-query CCDS DB by GeneID:12462See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 17468.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000001452.13 ENSMUSP00000001452.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000001452.13Link to Ensembl Protein Viewer:ENSMUSP00000001452.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000001452Re-query CCDS DB by Protein ID:ENSMUSP00000001452
Original member Current member NCBI NM_009836.1 NP_033966.1 Accepted alive Link to Nucleotide Sequence:NM_009836.1Link to Protein Sequence:NP_033966.1Re-query CCDS DB by Nucleotide ID:NM_009836Re-query CCDS DB by Protein ID:NP_033966Link to BLAST:NP_033966.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033966.1 545 P80318 545 100% 0 0

Chromosomal Locations for CCDS 17468.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 88297236 88297266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88299342 88299403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88300800 88300850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88300929 88300991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88302768 88302864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88305013 88305130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88309161 88309347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88311673 88311822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88313242 88313374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88313556 88313637 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88318346 88318526 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88320460 88320705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88321014 88321145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 88321444 88321548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1638 nt):
ATGATGGGCCACCGTCCAGTGCTCGTGCTCAGTCAGAACACAAAGCGTGAATCTGGAAGAAAAGTTCAGT
CT
GGAAATATCAATGCTGCAAAGACAATTGCAGACATCATCCGGACCTGCTTGGGACCTAAATCTATGAT
G
AAGATGCTTTTGGACCCAATGGGAGGCATCGTGATGACCAATGATGGCAATGCCATTCTTCGAGAGATT
CAA
GTCCAGCATCCCGCAGCAAAGTCCATGATTGAAATTAGCAGGACCCAGGATGAAGAGGTTGGAGATG
GG
ACCACATCAGTAATTATTCTTGCGGGAGAAATGCTCTCTGTGGCTGAACACTTCCTAGAGCAGCAGAT
G
CACCCAACAGTGGTGATCAGTGCTTACCGCATGGCACTGGATGATATGATCAGCACTCTGAAGAAAATC
AG
T
ACTCCTGTTGATGTCAATAACCGTGAGATGATGTTGAGCATCATCAATAGCTCTATTACTACAAAAG
TC
ATCAGTCGGTGGTCCTCCTTGGCATGCAACATTGCACTGGATGCTGTTAAGACTGTGCAGTTTGAAGA
G
AATGGCAGAAAGGAAATTGACATCAAAAAATATGCAAGGGTAGAAAAGATACCCGGGGGCATCATTGAA
GAC
TCATGTGTCTTACGTGGAGTTATGATTAACAAGGATGTGACCCATCCAAGGATGCGCCGCTATATTA
AG
AATCCTCGAATTGTGCTATTGGATTCTTCTTTGGAGTACAAGAAAGGAGAAAGCCAGACCGACATCGA
G
ATTACCCGGGAGGAGGACTTCACGCGGATCCTGCAGATGGAGGAGGAGTACATCCATCAGCTGTGTGAG
GAC
ATCATCCAGCTGAAGCCTGACGTGGTCATCACAGAGAAGGGCATCTCAGATTTAGCTCAGCACTACC
TC
ATGCGGGCCAATGTCACAGCCATTCGTAGAGTCCGGAAAACAGACAATAATCGCATTGCTAGAGCCTG
T
GGGGCACGGATAGTCAGCCGACCTGAGGAACTGAGAGAAGATGATGTTGGTACAGGGGCAGGCTTATTG
GAA
ATCAAGAAGATTGGAGATGAGTACTTTACATTCATCACTGACTGCAAAGACCCAAAGGCCTGCACCA
TT
CTTCTTAGAGGAGCCAGCAAAGAGATACTCTCGGAAGTAGAACGCAACCTCCAGGATGCCATGCAAGT
G
TGCCGCAATGTTCTACTGGACCCTCAGCTGGTGCCTGGTGGTGGAGCCTCTGAGATGGCTGTGGCTCAT
GCC
TTGACAGAAAAATCTAAGGCCATGACTGGTGTGGAACAATGGCCATATAGAGCTGTGGCCCAGGCGT
TA
GAGGTCATCCCTCGGACCTTGATCCAGAATTGTGGGGCCAGTACCATTCGTCTGCTTACCTCCCTTCG
G
GCCAAGCACACACAGGAGAGTTGTGAGACCTGGGGTGTGAATGGTGAGACTGGTACCTTGGTGGACATG
AAA
GAGCTGGGTATTTGGGAGCCATTGGCTGTGAAGCTACAAACGTACAAAACAGCAGTAGAGACTGCAG
TT
CTGCTTCTGCGGATTGATGACATTGTCTCTGGCCACAAGAAGAAGGGTGATGACCAGAACCGGCAAAC
T
GGTGCTCCAGATGCTGGCCAGGAGTGA


Translation (545 aa):
MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI
Q
VQHPAAKSMIEISRTQDEEVGDGTTSVIIL
AGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKI
S
TPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIE
D
SCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQ
TDIEITREEDFTRILQMEEEYIHQLCE
D
IIQLKPDVVITEKGIS
DLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL
E
IKKIGDEYFTFITDCKDPKACTILLRGASKEILS
EVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH
A
LTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLR
AKHTQESCETWGVNGETGTLVDM
K
ELGIWEPLAVKLQTYKTAVE
TAVLLLRIDDIVSGHKKKGDDQNRQTGAPDAGQE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser