NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS17895.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17895.1 Public Mus musculus 3 Ccn1 23 108 98 CCDS HistoryNCBI Gene:16007Re-query CCDS DB by CCDS ID:17895.1Re-query CCDS DB by GeneID:16007See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17895.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000029846.4 ENSMUSP00000029846.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029846.4Link to Ensembl Protein Viewer:ENSMUSP00000029846.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000029846Re-query CCDS DB by Protein ID:ENSMUSP00000029846
Original member Current member NCBI NM_010516.2 NP_034646.1 Accepted alive Link to Nucleotide Sequence:NM_010516.2Link to Protein Sequence:NP_034646.1Re-query CCDS DB by Nucleotide ID:NM_010516Re-query CCDS DB by Protein ID:NP_034646Link to BLAST:NP_034646.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034646.1 379 P18406 379 100% 0 0

Chromosomal Locations for CCDS 17895.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 145647666 145647968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 145648197 145648411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 145648533 145648877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 145649222 145649435 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 145649730 145649792 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1140 nt):
ATGAGCTCCAGCACCTTCAGGACGCTCGCTGTCGCCGTCACCCTTCTCCACTTGACCAGACTGGCGCTCT
CC
ACCTGCCCCGCCGCCTGCCACTGCCCTCTGGAGGCACCCAAGTGCGCCCCGGGAGTCGGGTTGGTCCG
G
GACGGCTGCGGCTGCTGTAAGGTCTGCGCTAAACAACTCAACGAGGACTGCAGCAAAACTCAGCCCTGC
GAC
CACACCAAGGGGTTGGAATGCAATTTCGGCGCCAGCTCCACCGCTCTGAAAGGGATCTGCAGAGCTC
AG
TCAGAAGGCAGACCCTGTGAATATAACTCCAGAATCTACCAAAACGGGGAAAGCTTCCAGCCCAACTG
T
AAACACCAGTGCACATGTATTGATGGCGCCGTGGGCTGCATTCCTCTGTGTCCCCAAGAACTGTCTCTC
CCC
AATCTGGGCTGTCCCAACCCCCGGCTGGTGAAAGTCAGCGGGCAGTGCTGTGAAGAGTGGGTTTGTG
AT
GAAGACAGCATTAAGGACTCCCTGGACGACCAGGATGACCTCCTCGGACTCGATGCCTCGGAGGTGGA
G
TTAACGAGAAACAATGAGTTAATCGCAATTGGAAAAGGCAGCTCACTGAAGAGGCTTCCTGTCTTTGGC
ACC
GAACCGCGAGTTCTTTTCAACCCTCTGCACGCCCATGGCCAGAAATGCATCGTTCAGACCACGTCTT
GG
TCCCAGTGCTCCAAGAGCTGCGGAACTGGCATCTCCACACGAGTTACCAATGACAACCCAGAGTGCCG
C
CTGGTGAAAGAGACCCGGATCTGTGAAGTGCGTCCTTGTGGACAACCAGTGTACAGCAGCCTAAAAAAG
GGC
AAGAAATGCAGCAAGACCAAGAAATCCCCAGAACCAGTCAGATTTACTTATGCAGGATGCTCCAGTG
TC
AAGAAATACCGGCCCAAATACTGCGGCTCCTGCGTAGATGGCCGGTGCTGCACACCTCTGCAGACCAG
A
ACTGTGAAGATGCGGTTCCGATGCGAAGATGGAGAGATGTTTTCCAAGAATGTCATGATGATCCAGTCC
TGC
AAATGTAACTACAACTGCCCGCATCCCAACGAGGCATCGTTCCGACTGTACAGCCTATTCAATGACA
TC
CACAAGTTCAGGGACTAA


Translation (379 aa):
MSSSTFRTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQLNEDCSKTQPC
D
HTKGLECNFGASSTALKGICR
AQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSL
P
NLGCPNPRLVKVSGQCCEEWVCDEDSIKDSLDDQDDLLGLDASEVELTRNNELIAIGKGSSLKRLP
VFG
T
EPRVLFNPLHAHGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLK
K
G
KKCSKTKKSPEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEMFSKNVMMIQS
C
KCNYNCPHPNEASFRLYSLFNDIHKFRD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser