NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18228.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18228.1 Public Mus musculus 4 Mup4 23 108 98 CCDS HistoryNCBI Gene:17843Re-query CCDS DB by CCDS ID:18228.1Re-query CCDS DB by GeneID:17843See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18228.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000075973.2 ENSMUSP00000075356.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000075973.2Link to Ensembl Protein Viewer:ENSMUSP00000075356.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000075973Re-query CCDS DB by Protein ID:ENSMUSP00000075356
Original member Current member NCBI NM_008648.2 NP_032674.1 Accepted alive Link to Nucleotide Sequence:NM_008648.2Link to Protein Sequence:NP_032674.1Re-query CCDS DB by Nucleotide ID:NM_008648Re-query CCDS DB by Protein ID:NP_032674Link to BLAST:NP_032674.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032674.1 178 P11590 178 100% 0 0

Chromosomal Locations for CCDS 18228.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 59957865 59957890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59958056 59958157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59958490 59958600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59959196 59959269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59960039 59960172 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59960510 59960599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (537 nt):
ATGAAGCTGCTGCTGTGTTTGGGACTGACCCTAGTCTGTATTCATGCAGAAGAAGCTACTTCCAAGGGAC
AG
AACTTAAATGTAGAAAAGATTAATGGGGAATGGTTTTCTATTCTCCTGGCCTCTGACAAAAGAGAAAA
G
ATAGAAGAACATGGCAGCATGAGAGTTTTTGTGGAGCACATCCATGTCTTGGAGAATTCCTTAGCTTTT
AAA
TTCCATACTGTTATAGATGGAGAGTGCTCTGAAATATTTTTGGTTGCTGACAAAACAGAGAAGGCTG
GT
GAATATTCTGTGATGTATGATGGATTCAATACATTTACTATACTTAAGACAGACTATGATAATTATAT
T
ATGTTTCATCTCATTAACGAAAAGGATGGGAAAACCTTCCAGCTGATGGAGCTCTATGGCCGAAAAGCA
GAT
TTGAATTCAGACATCAAGGAAAAGTTTGTAAAACTTTGTGAGGAGCATGGAATCATTAAAGAAAATA
TC
ATTGACTTAACCAAAACCAATCGCTGCCTCAAGGCCCGAGAATGA


Translation (178 aa):
MKLLLCLGLTLVCIHAEEATSKGQNLNVEKINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLENSLAF
K
FHT
VIDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFHLINEKDGKTFQLMELYGRKA
D
LNSDIKEKFVKLCEEHGIIKENIIDLTKT
NRCLKARE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser