NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18234.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18234.1 Public Mus musculus 4 Mup3 23 108 98 CCDS HistoryNCBI Gene:17842Re-query CCDS DB by CCDS ID:18234.1Re-query CCDS DB by GeneID:17842See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18234.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000084531.10 ENSMUSP00000081579.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084531.10Link to Ensembl Protein Viewer:ENSMUSP00000081579.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000084531Re-query CCDS DB by Protein ID:ENSMUSP00000081579
Original member Current member EBI ENSMUST00000107472.7 ENSMUSP00000103096.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107472.7Link to Ensembl Protein Viewer:ENSMUSP00000103096.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000107472Re-query CCDS DB by Protein ID:ENSMUSP00000103096
Original member Current member EBI ENSMUST00000107488.3 ENSMUSP00000103112.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107488.3Link to Ensembl Protein Viewer:ENSMUSP00000103112.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000107488Re-query CCDS DB by Protein ID:ENSMUSP00000103112
Original member Current member NCBI NM_001039544.2 NP_001034633.1 Accepted alive Link to Nucleotide Sequence:NM_001039544.2Link to Protein Sequence:NP_001034633.1Re-query CCDS DB by Nucleotide ID:NM_001039544Re-query CCDS DB by Protein ID:NP_001034633Link to BLAST:NP_001034633.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001034633.1 184 P04939 184 99.4565% 0 1

Chromosomal Locations for CCDS 18234.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 62084568 62084593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62084759 62084860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62085204 62085314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62085959 62086032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62086800 62086933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62087124 62087231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (555 nt):
ATGAAGCTGCTGCTGCCGCTGCTTCTGCTCCTGTGTTTGGAACTGACTTTAGTCTGTATCCATGCAGAAG
AA
TCTAGTTCTATGGAAAGGAACTTTAATGTAGAACAGATTAGTGGGTATTGGTTTTCTATTGCTGAAGC
C
TCTGATGAAAGAGAAAAGATAGAAGAACATGGCAGCATGAGAGCTTTTGTGGAAAACATCACTGTCTTG
GAG
AATTCCTTAGTCTTTAAATTCCATTTAATTGTAAATGAAGAGTGCACCGAAATGACTGCGATTGGTG
AA
CAAACAGAAAAGGCTGGCATATATTATATGAACTATGATGGATTCAATACATTTAGTATACTTAAGAC
A
GACTATGATAATTATATTATGATTCATCTCATTAACAAAAAGGATGGGAAAACCTTCCAGCTGATGGAG
CTC
TATGGCCGAGAACCAGATTTGAGTTTAGACATCAAGGAAAAGTTTGCAAAACTATGCGAGGAGCATG
GA
ATCATTAGAGAAAATATCATTGACCTAACCAATGTCAATCGCTGCCTCGAGGCCCGAGAATGA


Translation (184 aa):
MKLLLPLLLLLCLELTLVCIHAEESSSMERNFNVEQISGYWFSIAEASDEREKIEEHGSMRAFVENITVL
E
NSLVFKFHL
IVNEECTEMTAIGEQTEKAGIYYMNYDGFNTFSILKTDYDNYIMIHLINKKDGKTFQLME
L
Y
GREPDLSLDIKEKFAKLCEEHGIIRENIIDLTNVNRCLEARE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser