NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19103.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19103.1 Public Mus musculus 5 Fgl2 23 108 98 CCDS HistoryNCBI Gene:14190Re-query CCDS DB by CCDS ID:19103.1Re-query CCDS DB by GeneID:14190See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19103.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000035799.5 ENSMUSP00000046131.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035799.5Link to Ensembl Protein Viewer:ENSMUSP00000046131.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000035799Re-query CCDS DB by Protein ID:ENSMUSP00000046131
Original member Current member NCBI NM_008013.4 NP_032039.2 Accepted alive Link to Nucleotide Sequence:NM_008013.4Link to Protein Sequence:NP_032039.2Re-query CCDS DB by Nucleotide ID:NM_008013Re-query CCDS DB by Protein ID:NP_032039Link to BLAST:NP_032039.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032039.2 432 P12804 432 100% 0 0

Chromosomal Locations for CCDS 19103.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 21372717 21373308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 21375254 21375960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1299 nt):
ATGAGGCTTCCTGGTTGGTTGTGGCTGAGTTCTGCCGTCCTCGCTGCCTGCCGAGCGGTGGAGGAGCACA
AC
CTGACTGAGGGGCTGGAGGATGCCAGCGCCCAGGCTGCCTGCCCCGCGAGGCTGGAGGGCAGCGGGAG
G
TGCGAGGGGAGCCAGTGCCCCTTCCAGCTCACCCTGCCCACGCTGACCATCCAGCTCCCGCGGCAGCTT
GGC
AGCATGGAGGAGGTGCTCAAAGAAGTGCGGACCCTCAAGGAAGCAGTGGACAGTCTGAAGAAATCCT
GC
CAGGACTGTAAGTTGCAGGCTGACGACCATCGAGATCCCGGCGGGAATGGAGGGAATGGAGCAGAGAC
A
GCCGAGGACAGTAGAGTCCAGGAACTGGAGAGTCAGGTGAACAAGCTGTCCTCAGAGCTGAAGAATGCA
AAG
GACCAGATCCAGGGGCTGCAGGGGCGCCTGGAGACGCTCCATCTGGTAAATATGAACAACATTGAGA
AC
TACGTGGACAACAAAGTGGCAAATCTAACCGTTGTGGTCAACAGTTTGGATGGCAAGTGTTCCAAGTG
T
CCCAGCCAAGAACACATGCAGTCACAGCCGGTTCAACATCTAATATACAAAGATTGTTCCGACCACTAC
GTG
CTAGGAAGGAGAAGCAGTGGGGCCTACAGAGTTACCCCTGATCACAGAAACAGCAGCTTTGAGGTCT
AC
TGTGACATGGAGACCATGGGTGGAGGCTGGACGGTGCTGCAGGCTCGCCTTGATGGCAGCACCAACTT
C
ACCAGAGAGTGGAAAGACTACAAAGCCGGCTTTGGAAACCTTGAACGAGAATTTTGGTTGGGCAACGAT
AAA
ATTCATCTTCTGACCAAGAGTAAGGAAATGATTTTGAGAATAGATCTTGAAGACTTTAATGGTCTCA
CA
CTTTATGCCTTGTATGATCAGTTTTATGTGGCTAATGAATTTCTCAAATACCGATTACACATCGGTAA
C
TACAATGGCACGGCAGGGGATGCCTTGCGTTTCAGTCGACACTACAACCATGACCTGAGGTTTTTCACA
ACC
CCAGACAGAGACAACGATCGGTACCCCTCTGGGAACTGTGGGCTCTATTACAGCTCAGGCTGGTGGT
TT
GATTCATGTCTCTCTGCCAACTTAAATGGCAAATATTACCACCAGAAATACAAAGGTGTCCGTAATGG
G
ATTTTCTGGGGCACCTGGCCTGGTATAAACCAGGCACAGCCAGGTGGCTACAAGTCCTCCTTCAAACAG
GCC
AAGATGATGATTAGGCCCAAGAATTTCAAGCCATAA


Translation (432 aa):
MRLPGWLWLSSAVLAACRAVEEHNLTEGLEDASAQAACPARLEGSGRCEGSQCPFQLTLPTLTIQLPRQL
G
SMEEVLKEVRTLKEAVDSLKKSCQDCKLQADDHRDPGGNGGNGAETAEDSRVQELESQVNKLSSELKNA
K
DQIQGLQGRLETLHLVNMNNIENYVDNKVANLTVVVNSLDGKCSKCPSQEHMQSQP
VQHLIYKDCSDHY
V
LGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGND
K
IHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFT
T
PDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQ
A
KMMIRPKNFKP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser