NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19200.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19200.1 Public Mus musculus 5 Spon2 23 108 98 CCDS HistoryNCBI Gene:100689Re-query CCDS DB by CCDS ID:19200.1Re-query CCDS DB by GeneID:100689See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19200.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000046186.7 ENSMUSP00000042701.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046186.7Link to Ensembl Protein Viewer:ENSMUSP00000042701.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000046186Re-query CCDS DB by Protein ID:ENSMUSP00000042701
Original member Current member NCBI NM_133903.3 NP_598664.3 Accepted alive Link to Nucleotide Sequence:NM_133903.3Link to Protein Sequence:NP_598664.3Re-query CCDS DB by Nucleotide ID:NM_133903Re-query CCDS DB by Protein ID:NP_598664Link to BLAST:NP_598664.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598664.3 330 Q8BMS2 330 100% 0 0

Chromosomal Locations for CCDS 19200.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 33214468 33214652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 33215549 33215723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 33216333 33216524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 33216597 33216820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 33217244 33217460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (993 nt):
ATGGAAAACGTGAGTCTTGCCCTGGGCAGAGCTCTTTGGGTCTTCCTCCTGGCCATGATAGGCTCCACCA
CG
AGCCAGCCGCTGGGGGGAGAATCGGTTTGTACAGCCCGGCCTCTGGCTAGATACAGCATCACTTTCAT
T
GGCAAGTGGAGCCAGACAGCATTTCCCAAGCAGTACCCCCTGTTCCGGCCCCCTGCACAGTGGTCCTCT
CTG
CTGGGGGCAGCTCACAGCTCTGACTACAGCATGTGGCGGAAGAATGAGTATGTCAGCAATGGGCTGA
GG
GACTTTGCTGAGCGTGGTGAGGCCTGGGCACTGATGAAGGAGATCGAAGCTGCAGGAGAGAAACTTCA
G
AGTGTGCACGCAGTGTTCTCAGCTCCTGCCATCCCTAGCGGTACCGGGCAGACTTCCACAGAGTTAGAG
GTG
CACCCTAGGCACTCGCTGGTGTCCTTCGTGGTACGCATTGTCCCCAGCCCTGACTGGTTTGTGGGCA
TC
GACAGTCTGGACCTGTGTGAGGGAGGCCGCTGGAAGGAGCAGGTGGTCCTGGATCTTTATCCACACGA
T
GCAGGGACCGACAGTGGTTTCACCTTCTCCTCCCCTAACTTTGCAACTATCCCACAAGACACAGTGACT
GAG
ATAACAGCCTCATCGCCCAGCCACCCAGCAAATTCATTCTACTACCCACGCCTCAAGTCCTTACCTC
CC
ATCGCCAAAGTGACCTTCGTGCGGCTACAGCAGAGTCCCAGGGCCTTTGCCCCACCTTCCCTGGACCT
G
GCCAGCCGAGGCAACGAAATCGTTGACAGCCTTTCAGTTCCAGAGACACCGCTGGACTGTGAGGTTTCC
CTG
TGGTCATCCTGGGGACTGTGTGGAGGACCATGTGGAAAGTTGGGAGCCAAGAGCAGAACTCGCTATG
TC
CGTGTTCAGCCTGCTAACAATGGGACTCCCTGTCCCGAGCTTGAAGAAGAGGCCGAGTGTGCCCCAGA
T
AACTGCGTCTAA


Translation (330 aa):
MENVSLALGRALWVFLLAMIGSTTSQPLGGESVCTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSS
L
L
GAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELE
V
HPRHSL
VSFVVRIVPSPDWFVGIDSLDLCEGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVT
E
ITASSPSHPANSFYYPRLKSLPPIAKVTFVRLQQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVS
L
WSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELEEEAECAPDNCV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser