NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS19615.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19615.1 Public Mus musculus 5 Tbx5 23 108 98 CCDS HistoryNCBI Gene:21388Re-query CCDS DB by CCDS ID:19615.1Re-query CCDS DB by GeneID:21388See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19615.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000018407.9 ENSMUSP00000018407.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000018407.9Link to Ensembl Protein Viewer:ENSMUSP00000018407.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000018407Re-query CCDS DB by Protein ID:ENSMUSP00000018407
Original member Current member NCBI NM_011537.3 NP_035667.1 Accepted alive Link to Nucleotide Sequence:NM_011537.3Link to Protein Sequence:NP_035667.1Re-query CCDS DB by Nucleotide ID:NM_011537Re-query CCDS DB by Protein ID:NP_035667Link to BLAST:NP_035667.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035667.1 518 P70326 518 100% 0 0

Chromosomal Locations for CCDS 19615.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 119836914 119837060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119838696 119838790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119840767 119840886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119841753 119841900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119844965 119845117 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119853529 119853620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119871183 119871409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 119882913 119883487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1557 nt):
ATGGCCGATACAGATGAGGGCTTTGGCCTGGCGCGCACGCCTCTGGAGCCTGATTCCAAAGACAGGTCTT
GC
GATTCGAAACCTGAGAGTGCTCTGGGGGCTCCCAGCAAGTCTCCATCATCCCCGCAGGCTGCCTTCAC
C
CAGCAGGGCATGGAAGGAATCAAGGTGTTTCTTCATGAACGTGAACTGTGGCTGAAGTTCCACGAAGTG
GGC
ACAGAGATGATCATCACCAAGGCAGGGAGGAGAATGTTTCCTAGTTACAAAGTGAAGGTGACTGGCC
TT
AATCCCAAAACGAAGTATATTCTTCTCATGGATATTGTTCCCGCAGACGACCACAGATATAAATTTGC
T
GATAACAAATGGTCCGTAACTGGCAAAGCAGAGCCTGCCATGCCGGGGCGCCTTTACGTGCACCCGGAC
TCC
CCAGCAACCGGAGCCCACTGGATGCGACAACTTGTCTCCTTCCAGAAGCTCAAACTCACCAACAACC
AC
CTGGACCCGTTTGGACACATTATCCTGAACTCCATGCACAAATACCAGCCCCGATTACACATCGTGAA
A
GCAGACGAAAATAATGGGTTCGGTTCAAAGAACACTGCGTTTTGCACCCACGTCTTCCCGGAGACAGCT
TTT
ATCGCTGTGACTTCGTACCAGAATCACAAGATCACACAGCTGAAAATTGAGAACAACCCCTTCGCCA
AA
GGCTTTCGGGGCAGTGATGACCTGGAGTTACACAGGATGTCTCGGATGCAAAGTAAAGAGTATCCTGT
G
GTTCCCAGGAGCACAGTGAGGCACAAAGTCACCTCCAACCACAGCCCCTTCAGCAGCGAGACCCGAGCT
CTC
TCCACCTCATCCAATTTAGGGTCCCAGTACCAGTGTGAGAATGGTGTCTCTGGCCCCTCCCAGGACC
TT
CTGCCCCCACCTAACCCATACCCACTGGCCCAGGAGCACAGCCAAATTTACCACTGTACCAAGAGGAA
A
GATGAGGAATGTTCCAGCACGGAGCACCCCTATAAGAAGCCGTACATGGAGACATCCCCCAGCGAGGAA
GAC
ACCTTCTATCGCTCGGGCTACCCCCAGCAGCAGGGCCTGAGTACCTCTTACAGGACAGAGTCGGCCC
AG
CGGCAGGCCTGCATGTATGCCAGCTCCGCTCCCCCCAGCGAGCCCGTGCCTAGCCTGGAGGACATCAG
C
TGTAACACATGGCCCAGCATGCCCTCCTATAGCAGCTGTACCGTCACCACCGTGCAGCCCATGGACCGT
CTT
CCCTACCAGCACTTCTCCGCTCATTTCACCTCGGGGCCCCTGGTCCCTCGGTTGGCTGGCATGGCCA
AC
CATGGTTCTCCCCAGCTCGGCGAAGGGATGTTTCAGCACCAGACCTCAGTGGCCCATCAGCCTGTGGT
C
AGGCAGTGCGGGCCTCAGACTGGCCTTCAGTCTCCGGGCGGCCTCCAGCCCCCAGAGTTTCTCTACACT
CAC
GGCGTGCCCAGGACCCTGTCCCCCCATCAGTATCACTCGGTACACGGCGTCGGCATGGTGCCAGAGT
GG
AGTGAGAATAGCTAA


Translation (518 aa):
MADTDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV
G
TEMIITKAG
RRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPD
S
PATGAHWMRQLVSFQKLKLTNNHLDPFGH
IILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETA
F
IAVTSYQNHK
ITQLKIENNPFAKGFRGSDDLELHRMSRMQSKEYPVVPRSTVRHKVTSNHSPFSSETRA
L
STSSNLGSQYQCENGVSGPSQDLLPPPNPYPLAQEHSQIYHCTKRK
DEECSSTEHPYKKPYMETSPSEE
D
TFYRSGYPQQQGLSTSYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
L
PYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGGLQPPEFLYT
H
GVPRTLSPHQYHSVHGVGMVPEWSENS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser