NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21365.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21365.1 Public Mus musculus 7 St8sia2 23 108 98 CCDS HistoryNCBI Gene:20450Re-query CCDS DB by CCDS ID:21365.1Re-query CCDS DB by GeneID:20450See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21365.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000026896.9 ENSMUSP00000026896.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026896.9Link to Ensembl Protein Viewer:ENSMUSP00000026896.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000026896Re-query CCDS DB by Protein ID:ENSMUSP00000026896
Original member Current member NCBI NM_009181.2 NP_033207.2 Accepted alive Link to Nucleotide Sequence:NM_009181.2Link to Protein Sequence:NP_033207.2Re-query CCDS DB by Nucleotide ID:NM_009181Re-query CCDS DB by Protein ID:NP_033207Link to BLAST:NP_033207.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033207.2 375 O35696 375 100% 0 0

Chromosomal Locations for CCDS 21365.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 73943179 73943464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 73960692 73960985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 73966741 73966998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 73971918 73972046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 73976658 73976720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 74013397 74013494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1128 nt):
ATGCAGCTGCAGTTCCGGAGCTGGATGCTGGCCGCGCTTACGCTGCTCGTGGTCTTCCTCATCTTCGCAG
AC
ATCTCAGAGATCGAAGAAGAAATCGGGAATTCTGGAGGCAGAGGTACAATCAGATCAGCTGTGAACAG
C
TTACATAGCAAATCTAATAGAGCTGAAGTTGTAATAAATGGCTCTTCACCGCCAGCTGTCGCTGACAGA
AGT
AATGAAAGCCTTAAGCACAACATCCAGCCAGCCTCATCCAAATGGAGACACAACCAGACGCTCTCTC
TG
AGGATCAGGAAGCAAATTTTAAAGTTCTTGGATGCGGAGAAGGATATTTCTGTCCTTAAGGGGACCCT
G
AAGCCTGGAGACATTATTCATTATATCTTTGATCGAGACAGCACAATGAACGTGTCCCAGAACCTCTAT
GAA
CTCCTCCCCAGAACCTCACCTCTGAAGAATAAGCATTTCCAGACTTGTGCCATCGTGGGCAACTCGG
GG
GTCTTGCTGAACAGCGGCTGTGGCCAGGAGATTGACACACACAGCTTTGTCATAAGGTGCAACCTGGC
T
CCAGTTCAGGAGTATGCCCGGGATGTGGGCCTCAAGACAGACCTAGTGACCATGAACCCCTCTGTCATC
CAG
CGGGCCTTTGAGGACCTTGTGAACGCCACGTGGCGGGAGAAGCTGCTGCAGCGGCTGCACGGCCTCA
AT
GGGAGCATCCTGTGGATCCCTGCCTTCATGGCCCGGGGTGGCAAGGAGCGTGTGGAGTGGGTCAATGC
T
CTCATCCTGAAGCACCATGTGAACGTGCGCACGGCTTACCCTTCCCTGCGCCTGCTGCACGCAGTCCGA
GG
A
TATTGGCTGACCAACAAAGTCCACATCAAAAGACCAACCACCGGCCTCTTGATGTACACCCTGGCCA
CA
CGCTTCTGCAATCAGATCTACCTTTATGGCTTCTGGCCCTTCCCACTGGATCAGAATCAGAACCCCGT
C
AAGTATCACTATTATGACAGCCTCAAGTATGGCTACACTTCCCAGGCCAGCCCCCACACCATGCCCTTG
GAA
TTCAAGGCCCTCAAGAGCCTACATGAACAGGGGGCATTGAAACTGACTGTCGGCCAGTGTGATGGGG
CT
ACGTAA


Translation (375 aa):
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADR
S
NESLKHNIQPASSKWRHNQTLSLRI
RKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLY
E
LLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVI
RCNLAPVQEYARDVGLKTDLVTMNPSVI
Q
RAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVR

G
YWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPL
E
FKALKSLHEQGALKLTVGQCDGAT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser