NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, September 23, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21368.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21368.1 Public Mus musculus 7 Sv2b 23 108 98 CCDS HistoryNCBI Gene:64176Re-query CCDS DB by CCDS ID:21368.1Re-query CCDS DB by GeneID:64176See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21368.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000085164.6 ENSMUSP00000082254.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000085164.6Link to Ensembl Protein Viewer:ENSMUSP00000082254.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000085164Re-query CCDS DB by Protein ID:ENSMUSP00000082254
Original member Current member EBI ENSMUST00000165175.7 ENSMUSP00000127245.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165175.7Link to Ensembl Protein Viewer:ENSMUSP00000127245.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000165175Re-query CCDS DB by Protein ID:ENSMUSP00000127245
Original member Current member EBI ENSMUST00000206344.1 ENSMUSP00000146049.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000206344.1Link to Ensembl Protein Viewer:ENSMUSP00000146049.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000206344Re-query CCDS DB by Protein ID:ENSMUSP00000146049
Original member Current member NCBI NM_001109753.1 NP_001103223.1 Accepted alive Link to Nucleotide Sequence:NM_001109753.1Link to Protein Sequence:NP_001103223.1Re-query CCDS DB by Nucleotide ID:NM_001109753Re-query CCDS DB by Protein ID:NP_001103223Link to BLAST:NP_001103223.1
Original member Current member NCBI NM_001360571.1 NP_001347500.1 Accepted alive Link to Nucleotide Sequence:NM_001360571.1Link to Protein Sequence:NP_001347500.1Re-query CCDS DB by Nucleotide ID:NM_001360571Re-query CCDS DB by Protein ID:NP_001347500Link to BLAST:NP_001347500.1
Original member Current member NCBI NM_001360572.1 NP_001347501.1 Accepted alive Link to Nucleotide Sequence:NM_001360572.1Link to Protein Sequence:NP_001347501.1Re-query CCDS DB by Nucleotide ID:NM_001360572Re-query CCDS DB by Protein ID:NP_001347501Link to BLAST:NP_001347501.1
Original member Current member NCBI NM_001360573.1 NP_001347502.1 Accepted alive Link to Nucleotide Sequence:NM_001360573.1Link to Protein Sequence:NP_001347502.1Re-query CCDS DB by Nucleotide ID:NM_001360573Re-query CCDS DB by Protein ID:NP_001347502Link to BLAST:NP_001347502.1
Original member Current member NCBI NM_001360574.1 NP_001347503.1 Accepted alive Link to Nucleotide Sequence:NM_001360574.1Link to Protein Sequence:NP_001347503.1Re-query CCDS DB by Nucleotide ID:NM_001360574Re-query CCDS DB by Protein ID:NP_001347503Link to BLAST:NP_001347503.1
Original member Current member NCBI NM_001360575.1 NP_001347504.1 Accepted alive Link to Nucleotide Sequence:NM_001360575.1Link to Protein Sequence:NP_001347504.1Re-query CCDS DB by Nucleotide ID:NM_001360575Re-query CCDS DB by Protein ID:NP_001347504Link to BLAST:NP_001347504.1
Original member Current member NCBI NM_153579.4 NP_705807.2 Accepted alive Link to Nucleotide Sequence:NM_153579.4Link to Protein Sequence:NP_705807.2Re-query CCDS DB by Nucleotide ID:NM_153579Re-query CCDS DB by Protein ID:NP_705807Link to BLAST:NP_705807.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103223.1 683 Q8BG39 683 100% 0 0
NP_001347500.1 683 Q8BG39 683 100% 0 0
NP_001347501.1 683 Q8BG39 683 100% 0 0
NP_001347502.1 683 Q8BG39 683 100% 0 0
NP_001347503.1 683 Q8BG39 683 100% 0 0
NP_001347504.1 683 Q8BG39 683 100% 0 0
NP_705807.2 683 Q8BG39 683 100% 0 0

Chromosomal Locations for CCDS 21368.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 75117595 75117778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75119925 75120084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75124014 75124214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75125571 75125704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75136298 75136462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75140076 75140164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75140979 75141089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75147637 75147726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75148955 75149088 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75156607 75156758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75157269 75157449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 75206090 75206540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2052 nt):
ATGGATGACTACAGGTATCGGGACAACTATGAGGGCTATGCCCCTAGTGATGGCTACTACCGTAGCAATG
AG
CAGAATCAGGAAGAAGATGCACAGAGCGATGTTACAGAAGGCCATGACGAGGAAGATGAGATCTATGA
A
GGCGAGTACCAAGGCATCCCTCATCCAGATGATGTCAAGTCTAAGCAGACCAAGATGGCGCCCTCCAGA
GCA
GATGGTCTTGGGGGCCAGGCAGACTTGATGGCTGAGAGGATGGAAGATGAGGAGGAGCTGGCTCACC
AA
TATGAGACCATCATTGATGAGTGTGGCCATGGGCGCTTCCAGTGGACCCTCTTCTTCGTCTTGGGTTT
G
GCCTTGATGGCTGATGGAGTGGAAATATTTGTAGTGAGCTTTGCTCTGCCAAGTGCAGAGAAAGACATG
TGT
CTGTCCAGTTCCAAGAAAGGAATGCTTGGGCTGATAGTCTACCTAGGAATGATGGCAGGGGCCTTCA
TC
TTGGGCGGCCTGGCTGATAAACTGGGAAGGAAGAAGGTCCTCAGCATGTCACTGGCCATCAATGCCTC
C
TTTGCTTCACTCTCCTCCTTCGTGCAGGGATATGGAGCCTTCCTCTTCTGCAGACTCATCTCAGGCATA
GG
G
ATTGGGGGCTCCCTGCCAATTGTTTTTGCCTACTTTTCTGAGTTCTTATCACGAGAGAAACGCGGTG
AG
CATCTTAGCTGGCTGGGCATCTTCTGGATGACTGGAGGCATCTATGCATCTGCCATGGCCTGGAGCAT
C
ATTCCACACTATGGCTGGGGCTTCAGCATGGGGACTAATTACCACTTCCACAGCTGGAGAGTGTTTGTC
ATC
GTCTGTGCTCTGCCCGCCACTGTGTCCATGGTGGCTCTGAAGTTCATGCCAGAAAGCCCCAGGTTCC
TG
CTGGAGATGGGCAAACATGATGAAGCCTGGATGATTCTCAAACAAGTCCATGATACAAACATGAGAGC
T
AAGGGGACCCCGGAAAAGGTGTTCACGGTTTCCCACATCAAAACTCCCAAGCAAATGGATGAATTCATT
GAG
ATACAGAGCTCAACCGGAACTTGGTACCAGCGCTGGCTGGTCAGGTTCATGACCATTTTCAAACAGG
TC
TGGGATAACGCCTTGTACTGTGTGATGGGGCCCTACAGAATGAACACCCTGATTCTGGCTGTGGTCTG
G
TTCACCATGGCCTTAAGTTACTACGGCCTGACGGTGTGGTTCCCCGACATGATCCGCTATTTCCAGGAT
GAA
GAATATAAGTCTAAAATGAAGGTGTTTTTTGGTGAGCACGTGCATGGCGCCACGATCAACTTTACCA
TG
GAAAACCAGATCCACCAACATGGGAAGCTTGTGAACGATAAGTTCATAAAGATGTATTTTAAACATGT
C
CTCTTTGAGGACACATTCTTTGACAAATGCTATTTTGAAGATGTGACATCCACAGATACGTATTTCAAG
AAC
TGCACCATCGAATCGACCACCTTCTACAACACAGACCTCTACAAACACAAGTTCATCAACTGTCGGT
TT
ATCAATTCCACCTTTCTGGAGCAGAAGGAGGGCTGCCACATGGACTTTGAAGAGGACAATGATTTTCT
G
ATTTACCTCGTCAGCTTCCTCGGCAGCCTCTCTGTCTTGCCTGGGAACATAATTTCTGCCCTGCTCATG
GAC
AGAATTGGAAGACTCAAGATGATTGGCGGCTCCATGCTCATCTCTGCAGTCTGCTGCTTCTTCCTGT
TT
TTTGGCAACAGCGAGTCTGCGATGATCGGCTGGCAATGCCTGTTCTGTGGGACCAGCATTGCAGCCTG
G
AATGCTCTGGATGTGATCACAGTTGAGCTGTATCCCACCAACCAGAGGGCCACGGCCTTCGGCATCCTC
AAC
GGACTGTGCAAGTTTGGGGCCATCCTGGGAAACACTATCTTTGCTTCTTTTGTTGGGATAACCAAAG
TG
GTCCCCATCCTTCTGGCTGCTGCTTCTCTGGTTGGAGGTGGCCTGATTGCCCTTCGATTGCCAGAGAC
T
CGAGAGCAAGTCCTGATGTGA


Translation (683 aa):
MDDYRYRDNYEGYAPSDGYYRSNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKSKQTKMAPSR
A
DGLGGQADLMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDM
C
LSSSKKGML
GLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGI
G
IGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFV
I
VCALPATVSMVALKFMPESPRFLLE
MGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFI
E
IQSSTGTWYQRWLVRFMTIFKQ
VWDNALYCVMGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQD
E
EYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVND
KFIKMYFKHVLFEDTFFDKCYFEDVTSTDTYFK
N
CTIESTTFYNT
DLYKHKFINCRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLM
D
RIGRLKMI
GGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGIL
N
GLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser