NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS21842.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21842.1 Public Mus musculus 7 Ypel3 23 108 98 CCDS HistoryNCBI Gene:66090Re-query CCDS DB by CCDS ID:21842.1Re-query CCDS DB by GeneID:66090See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21842.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000038614.11 ENSMUSP00000037332.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038614.11Link to Ensembl Protein Viewer:ENSMUSP00000037332.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000038614Re-query CCDS DB by Protein ID:ENSMUSP00000037332
Original member Current member EBI ENSMUST00000106356.1 ENSMUSP00000101963.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106356.1Link to Ensembl Protein Viewer:ENSMUSP00000101963.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106356Re-query CCDS DB by Protein ID:ENSMUSP00000101963
Original member Current member EBI ENSMUST00000106357.7 ENSMUSP00000101964.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106357.7Link to Ensembl Protein Viewer:ENSMUSP00000101964.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000106357Re-query CCDS DB by Protein ID:ENSMUSP00000101964
Original member Current member EBI ENSMUST00000170882.7 ENSMUSP00000128753.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000170882.7Link to Ensembl Protein Viewer:ENSMUSP00000128753.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000170882Re-query CCDS DB by Protein ID:ENSMUSP00000128753
Original member NCBI NM_025347.2 NP_079623.1 Updated not alive Link to Nucleotide Sequence:NM_025347.2Link to Protein Sequence:NP_079623.1Re-query CCDS DB by Nucleotide ID:NM_025347Re-query CCDS DB by Protein ID:NP_079623
Current member NCBI NM_025347.3 NP_079623.1 Accepted alive Link to Nucleotide Sequence:NM_025347.3Link to Protein Sequence:NP_079623.1Re-query CCDS DB by Nucleotide ID:NM_025347Re-query CCDS DB by Protein ID:NP_079623Link to BLAST:NP_079623.1
Original member NCBI NM_026875.2 NP_081151.2 Updated not alive Link to Nucleotide Sequence:NM_026875.2Link to Protein Sequence:NP_081151.2Re-query CCDS DB by Nucleotide ID:NM_026875Re-query CCDS DB by Protein ID:NP_081151
Current member NCBI NM_026875.3 NP_081151.2 Accepted alive Link to Nucleotide Sequence:NM_026875.3Link to Protein Sequence:NP_081151.2Re-query CCDS DB by Nucleotide ID:NM_026875Re-query CCDS DB by Protein ID:NP_081151Link to BLAST:NP_081151.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079623.1 119 P61237 119 100% 0 0
NP_081151.2 119 P61237 119 100% 0 0

Chromosomal Locations for CCDS 21842.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 126777837 126777953 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 126778054 126778097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 126778306 126778414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 126780027 126780116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (360 nt):
ATGGTGCGGATTTCAAAGCCCAAGACGTTTCAGGCCTACTTGGATGACTGTCACCGGAGGTATAGCTGTG
CCCACTGCCGTGCTCACCTGGCCAACCACGACGACCTCATCTCCAAGTCCTTCCAGGGCAGTCAGGGACG
TGCCTACCTCTTCAACTCTGTAGTGAATGTGGGCTGCGGGCCAGCAGAAGAGCGGGTGCTGCTGACAGGT
CTTCATGCTGTCGCTGACATCCACTGTGAGAACTGCAAGACCACTTTGGGCTGGAAATATGAGCAAGCCT
TTGAGAGCAGCCAGAAGTACAAAGAGGGGAAATACATCATTGAACTCAACCACATGATCAAAGACAACGG
CTGGGACTGA

Translation (119 aa):
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG
LHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH