NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24707.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24707.1 Public Mus musculus 11 Gm2a 23 108 98 CCDS HistoryNCBI Gene:14667Re-query CCDS DB by CCDS ID:24707.1Re-query CCDS DB by GeneID:14667See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24707.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000000608.7 ENSMUSP00000000608.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000608.7Link to Ensembl Protein Viewer:ENSMUSP00000000608.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000000608Re-query CCDS DB by Protein ID:ENSMUSP00000000608
Original member Current member NCBI NM_010299.3 NP_034429.1 Accepted alive Link to Nucleotide Sequence:NM_010299.3Link to Protein Sequence:NP_034429.1Re-query CCDS DB by Nucleotide ID:NM_010299Re-query CCDS DB by Protein ID:NP_034429Link to BLAST:NP_034429.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034429.1 193 Q60648 193 100% 0 0

Chromosomal Locations for CCDS 24707.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 55098164 55098244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 55103587 55103748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 55108898 55109080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 55109378 55109533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (582 nt):
ATGCACCGTCTACCGCTGCTGCTCCTGCTGGGCTTGCTGCTCGCAGGCTCCGTCGCCCCTGCGCGCCTCG
TC
CCGAAGCGCCTTTCCCAACTTGGTGGCTTCTCCTGGGATAACTGTGATGAAGGAAAGGACCCTGCAGT
G
ATCAAAAGCCTCACGATCCAACCTGACCCCATTGTGGTTCCTGGAGATGTAGTCGTCAGCCTTGAGGGC
AAG
ACCAGCGTTCCCCTCACTGCTCCTCAGAAGGTGGAGCTCACCGTGGAGAAGGAAGTGGCTGGCTTCT
GG
GTCAAGATTCCTTGTGTAGAACAGCTAGGCAGCTGTAGCTACGAGAACATCTGTGACCTGATAGACGA
A
TACATTCCTCCTGGAGAGAGCTGCCCAGAGCCCCTGCACACCTACGGGCTGCCCTGCCACTGTCCCTTC
AAG
GAAGGTACCTACTCACTACCCACGAGCAACTTCACAGTGCCTGACCTAGAGCTACCGAGCTGGCTGA
GC
ACAGGCAACTACCGCATCCAGAGTATCTTGAGCAGTGGTGGGAAGCGCCTGGGCTGCATCAAGATTGC
T
GCCTCTCTCAAGGGCAGATAA


Translation (193 aa):
MHRLPLLLLLGLLLAGSVAPARLVPKRLSQLGGFSWDNCDEGKDPAVIKSLTIQPDPIVVPGDVVVSLEG
K
TSVPLTAPQK
VELTVEKEVAGFWVKIPCVEQLGSCSYENICDLIDEYIPPGESCPEPLHTYGLPCHCPF
K
E
GTYSLPTSNFTVPDLELPSWLSTGNYRIQSILSSGGKRLGCIKIAASLKGR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser