NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24813.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24813.1 Public Mus musculus 11 Mfap4 23 108 98 CCDS HistoryNCBI Gene:76293Re-query CCDS DB by CCDS ID:24813.1Re-query CCDS DB by GeneID:76293See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24813.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000064783.9 ENSMUSP00000070848.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000064783.9Link to Ensembl Protein Viewer:ENSMUSP00000070848.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000064783Re-query CCDS DB by Protein ID:ENSMUSP00000070848
Original member Current member NCBI NM_029568.3 NP_083844.1 Accepted alive Link to Nucleotide Sequence:NM_029568.3Link to Protein Sequence:NP_083844.1Re-query CCDS DB by Nucleotide ID:NM_029568Re-query CCDS DB by Protein ID:NP_083844Link to BLAST:NP_083844.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083844.1 257 Q9D1H9-1 257 100% 0 0

Chromosomal Locations for CCDS 24813.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 61485480 61485485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61485721 61485805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61486038 61486192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61486910 61487006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61487079 61487261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 61487754 61488001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (774 nt):
ATGAAGGCCCTCCCAGCCCTGCCACTGATGCTGATGCTGCTCTCCATGCCTCCCCCCTGCGCCCCGCAAG
CC
TCTGGGATCCGGGGAGATGCTCTGGAGAAGTCCTGTCTTCAGCAACCCCTGGACTGTGATGATATCTA
C
GCCCAGGGCTATCAGGAAGACGGCGTGTATCTCATCTACCCCTATGGCCCCAGTGTGCCGGTGCCCGTC
TTC
TGCGACATGACAACTGAGGGCGGCAAGTGGACGGTTTTCCAGAAAAGATTCAACGGCTCAGTGAGTT
TC
TTCCGGGGCTGGAGCGACTACAAGCTGGGCTTTGGCCGTGCTGACGGGGAGTACTGGCTGGGGCTGCA
G
AACCTGCACCTCCTGACACTGAAGCAGAAGTATGAGCTGCGCGTGGACTTGGAAGACTTTGAGAACAAC
ACA
GCCTATGCCAAGTACATTGACTTCTCCATCTCCCCCAACGCCATCAGTGCTGAGGAGGATGGCTATA
CC
CTCTACGTGGCTGGCTTCGAGGATGGCGGGGCAGGTGACTCACTGTCCTACCACAGTGGCCAGAAGTT
C
TCCACCTTTGATCGGGACCAGGACCTCTTCGTGCAGAACTGTGCAGCCCTCTCCTCAGGAGCCTTCTGG
TTC
CGAAGCTGCCATTTCGCCAATCTCAACGGTTTCTACCTGGGTGGTTCCCATCTCTCCTATGCCAATG
GC
ATCAATTGGGCCCAATGGAAAGGCTTCTATTACTCCCTCAAGCGCACGGAGATGAAAATTCGTCGGGC
C
TGA


Translation (257 aa):
MKALPALPLMLMLLSMPPPCAPQASGIRGDALEKSCLQQPLDCDDIYAQGYQEDGVYLIYPYGPSVPVPV
F
CDMTTEGGKWT
VFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGLQNLHLLTLKQKYELRVDLEDFENN
T
AYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGA
GDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFW
F
RSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser