NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS25171.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25171.1 Public Mus musculus 11 Ccl6 23 108 98 CCDS HistoryNCBI Gene:20305Re-query CCDS DB by CCDS ID:25171.1Re-query CCDS DB by GeneID:20305See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25171.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000019071.3 ENSMUSP00000019071.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019071.3Link to Ensembl Protein Viewer:ENSMUSP00000019071.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000019071Re-query CCDS DB by Protein ID:ENSMUSP00000019071
Original member Current member NCBI NM_009139.3 NP_033165.1 Accepted alive Link to Nucleotide Sequence:NM_009139.3Link to Protein Sequence:NP_033165.1Re-query CCDS DB by Nucleotide ID:NM_009139Re-query CCDS DB by Protein ID:NP_033165Link to BLAST:NP_033165.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033165.1 116 P27784 116 100% 0 0

Chromosomal Locations for CCDS 25171.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 83588825 83588939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 83589303 83589414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 83589757 83589804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 83592866 83592941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (351 nt):
ATGAGAAACTCCAAGACTGCCATTTCATTCTTTATCCTTGTGGCTGTCCTTGGGTCCCAGGCTGGCCTCA
TA
CAAGAAATGGAAAAAGAAGATCGTCGCTATAACCCTCCAATAATTCATCAAGGCTTTCAAGACACTTC
T
TCAGACTGCTGCTTCTCTTATGCCACACAGATCCCATGTAAAAGATTTATATATTATTTCCCCACCAGT
GGT
GGGTGCATCAAGCCGGGCATCATCTTTATCAGCAGGAGGGGAACCCAGGTCTGTGCCGACCCCAGCG
AT
CGGAGAGTTCAGAGGTGCCTAAGCACCCTGAAGCAAGGCCCAAGATCTGGGAACAAGGTCATTGCTTG
A


Translation (116 aa):
MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTS
G
GCIKPGI
IFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser