NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26119.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26119.1 Public Mus musculus 12 Lgmn 23 108 98 CCDS HistoryNCBI Gene:19141Re-query CCDS DB by CCDS ID:26119.1Re-query CCDS DB by GeneID:19141See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26119.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000021607.8 ENSMUSP00000021607.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021607.8Link to Ensembl Protein Viewer:ENSMUSP00000021607.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000021607Re-query CCDS DB by Protein ID:ENSMUSP00000021607
Original member Current member EBI ENSMUST00000110020.7 ENSMUSP00000105647.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110020.7Link to Ensembl Protein Viewer:ENSMUSP00000105647.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000110020Re-query CCDS DB by Protein ID:ENSMUSP00000105647
Original member NCBI NM_011175.3 NP_035305.1 Updated not alive Link to Nucleotide Sequence:NM_011175.3Link to Protein Sequence:NP_035305.1Re-query CCDS DB by Nucleotide ID:NM_011175Re-query CCDS DB by Protein ID:NP_035305
Current member NCBI NM_011175.4 NP_035305.1 Accepted alive Link to Nucleotide Sequence:NM_011175.4Link to Protein Sequence:NP_035305.1Re-query CCDS DB by Nucleotide ID:NM_011175Re-query CCDS DB by Protein ID:NP_035305Link to BLAST:NP_035305.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035305.1 435 O89017 435 100% 0 0

Chromosomal Locations for CCDS 26119.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 102394570 102394612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102394842 102394909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102395644 102395814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102398183 102398383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102399905 102399994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102400138 102400256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102401885 102401951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102402670 102402732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102403427 102403502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102404260 102404345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102405796 102405877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102413465 102413562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102423585 102423728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1308 nt):
ATGACCTGGAGAGTGGCTGTGCTTCTCAGCCTGGTGCTGGGTGCTGGTGCCGTTCCCGTCGGTGTGGACG
AT
CCCGAGGATGGAGGCAAGCACTGGGTGGTGATTGTGGCGGGCTCCAATGGCTGGTATAATTACCGACA
C
CAGGCAGACGCATGCCACGCCTACCAGATCATCCACCGGAACGGGATTCCTGACGAGCAGATCATAGTG
ATG
ATGTATGACGACATTGCCAACTCTGAAGAAAACCCTACCCCAGGTGTTGTGATCAACCGACCTAACG
GC
ACAGATGTATACAAGGGAGTCCTGAAGGACTACACCGGAGAGGATGTGACTCCAGAGAATTTCCTCGC
C
GTGCTGAGAGGTGACGCAGAAGCTGTGAAGGGCAAAGGGTCTGGAAAAGTCTTGAAGAGTGGCCCCCGA
GAT
CATGTCTTCATTTACTTCACCGACCACGGAGCCACCGGGATCCTGGTGTTTCCTAATGATGATCTTC
AT
GTCAAGGACCTGAATAAGACTATTCGCTACATGTATGAACACAAAATGTACCAGAAGATGGTGTTCTA
C
ATTGAAGCTTGTGAGTCTGGCTCCATGATGAACCACCTGCCCGACGACATCAACGTTTATGCAACTACT
GCG
GCCAACCCCAAGGAGTCATCTTATGCCTGCTACTACGACGAGGAGAGGGGCACTTACCTGGGTGACT
GG
TACAGCGTCAACTGGATGGAAGACTCCGATGTGGAGGACCTGACCAAAGAGACCCTTCACAAGCAGTA
C
CACCTGGTCAAGTCCCACACCAACACCAGCCATGTCATGCAATATGGGAACAAATCTATCTCTACCATG
AAA
GTGATGCAGTTTCAGGGAATGAAGCACAGAGCCAGTTCCCCCATCTCCCTGCCTCCGGTCACACACC
TT
GACCTCACCCCCAGCCCTGACGTGCCCCTGACCATCTTGAAGAGGAAGCTGCTGAGAACCAACGACGT
G
AAGGAATCCCAGAATCTCATTGGGCAGATCCAGCAATTTCTGGATGCCAGGCACGTCATTGAGAAGTCT
GTG
CACAAGATCGTTTCCCTGCTGGCGGGATTTGGGGAAACTGCTGAGAGACATCTGTCAGAGAGGACCA
TG
CTCACAGCACATGACTGCTACCAGGAGGCTGTAACCCACTTCCGCACACACTGCTTTAACTGGCACTC
T
GTCACGTACGAGCATGCCTTGCGGTACTTGTATGTGCTGGCCAATCTCTGTGAGGCACCATATCCGATT
GAC
AGGATAGAGATGGCCATGGACAAAGTGTGTCTTAGTCACTACTGA


Translation (435 aa):
MTWRVAVLLSLVLGAGAVPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIV
M
MYDDIANSE
ENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPR
D
HVFIYFTDHGATGILVFPNDD
LHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATT
A
ANPKESSYACYYDEERGTYLGDWYSVNWMEDSDV
EDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTM
K
VMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLD
ARHVIEKS
V
HKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVT
YEHALRYLYVLANLCEAPYPI
D
RIEMAMDKVCLSHY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser