NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26428.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26428.1 Public Mus musculus 13 Serpinb1a 23 108 98 CCDS HistoryNCBI Gene:66222Re-query CCDS DB by CCDS ID:26428.1Re-query CCDS DB by GeneID:66222See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26428.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000076352.7 ENSMUSP00000075690.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000076352.7Link to Ensembl Protein Viewer:ENSMUSP00000075690.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000076352Re-query CCDS DB by Protein ID:ENSMUSP00000075690
Original member Current member NCBI NM_025429.2 NP_079705.2 Accepted alive Link to Nucleotide Sequence:NM_025429.2Link to Protein Sequence:NP_079705.2Re-query CCDS DB by Nucleotide ID:NM_025429Re-query CCDS DB by Protein ID:NP_079705Link to BLAST:NP_079705.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079705.2 379 Q9D154 379 100% 0 0

Chromosomal Locations for CCDS 26428.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 32842818 32843222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 32845309 32845476 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 32845671 32845813 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 32847390 32847507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 32848619 32848756 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 32850239 32850406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1140 nt):
ATGGAGCAGCTGAGTTCAGCCAACACCCTCTTCGCCTTGGAGCTGTTCCAAACCCTGAATGAAAGCAGCC
CC
ACAGGAAACATCTTCTTCTCTCCCTTCAGCATTTCTTCTGCCTTGGCCATGGTCATTCTGGGGGCCAA
A
GGCAGCACTGCAGCTCAGCTTTCTAAGACTTTTCATTTTGACTCTGTTGAGGACATCCATTCACGCTTC
CAA
AGCCTGAATGCTGAAGTGAGCAAACGTGGAGCATCTCACACTCTGAAACTTGCTAACAGACTGTATG
GA
GAGAAAACCTACAACTTCCTTCCTGAATACTTGGCTTCAACCCAGAAAATGTATGGTGCTGACTTGGC
C
CCTGTGGATTTTCTGCATGCCTCTGAGGATGCAAGGAAGGAGATAAACCAGTGGGTCAAAGGTCAAACA
GAA
GGGAAAATCCCAGAACTGTTGTCTGTGGGTGTGGTGGACAGTATGACCAAACTTGTGCTGGTGAATG
CC
ATCTACTTTAAGGGAATGTGGGAGGAGAAATTCATGACAGAGGACACAACGGATGCTCCATTCCGACT
G
AGTAAGAAAGACACAAAAACAGTGAAGATGATGTATCAAAAGAAAAAATTTCCATTTGGTTACATTTCG
GAC
CTGAAGTGCAAGGTGCTGGAGATGCCTTACCAGGGTGGAGAACTTAGCATGGTCATTCTGCTGCCTA
AA
GACATTGAGGACGAGTCCACGGGTCTTAAGAAGATTGAAAAGCAAATAACTTTGGAAAAACTGCTTGA
A
TGGACCAAACGTGAGAACTTGGAATTCATTGATGTCCACGTCAAACTGCCCCGGTTCAAGATAGAAGAG
AGC
TATACCCTCAACTCTAACCTGGGCCGCCTGGGAGTGCAGGATCTCTTTAGCAGTAGCAAGGCTGATC
TC
TCTGGCATGTCAGGATCCAGAGATCTTTTCATATCAAAAATTGTCCACAAGTCCTTTGTGGAAGTGAA
T
GAGGAAGGAACAGAGGCAGCCGCTGCTACAGGAGGCATTGCTACATTCTGTATGTTGTTGCCTGAGGAA
GAA
TTCACAGTGGACCATCCGTTCATTTTCTTCATTCGGCACAATCCCACATCTAATGTGCTCTTCCTTG
GC
AGGGTTTGTTCCCCATAG


Translation (379 aa):
MEQLSSANTLFALELFQTLNESSPTGNIFFSPFSISSALAMVILGAKGSTAAQLSKTFHFDSVEDIHSRF
Q
SLNAEVSKRGASHTLKLANRLYGEKTYNFLP
EYLASTQKMYGADLAPVDFLHASEDARKEINQWVKGQT
E
GKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTEDTTDAPFRLSKKDTKTVKMMYQKKKFPFGYIS
D
LKCKVLEMPYQGGELSMVILLPKDIEDESTGLKK
IEKQITLEKLLEWTKRENLEFIDVHVKLPRFKIEE
S
YTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTEAAAATGGIATFCMLLPEE
E
FTVDHPFIFFIRHNPTSNVLFLGRVCSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser