NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26525.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26525.1 Public Mus musculus 13 Sfxn1 23 108 98 CCDS HistoryNCBI Gene:14057Re-query CCDS DB by CCDS ID:26525.1Re-query CCDS DB by GeneID:14057See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26525.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000021930.9 ENSMUSP00000021930.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021930.9Link to Ensembl Protein Viewer:ENSMUSP00000021930.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000021930Re-query CCDS DB by Protein ID:ENSMUSP00000021930
Original member Current member NCBI NM_027324.5 NP_081600.1 Accepted alive Link to Nucleotide Sequence:NM_027324.5Link to Protein Sequence:NP_081600.1Re-query CCDS DB by Nucleotide ID:NM_027324Re-query CCDS DB by Protein ID:NP_081600Link to BLAST:NP_081600.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081600.1 322 Q99JR1 322 100% 0 0

Chromosomal Locations for CCDS 26525.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 54085460 54085623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54088889 54089059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54091223 54091321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54092373 54092448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54093001 54093086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54093854 54093981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54096731 54096780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54104802 54104851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54105748 54105795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 54106507 54106603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (969 nt):
ATGTCTGGGGAAGTGCCACCCAACATTAACATCAAGGAGCCTCGATGGGACCAGAGCACGTTCATTGGCC
GA
GCCAGTCACTTCTTCACGGTTACTGATCCCAGAAATATCCTTTTAACGAACGAACAGCTAGAGAATGC
G
AGGAAAGTGGTGCATGACTACAGGCAAGGAATCGTTCCTGCCGGCCTCACGGAAAATGAGCTATGGAGA
GCG
AAGTACGCGTACGACTCGGCCTTCCATCCTGACACCGGTGAAAAGATGACTCTGATAGGAAGAATGT
CA
GCTCAGGTCCCGATGAACATGACCATCACAGGCTGCATGATGACCTTCTACCGGACCACACCGGCTGT
G
CTTTTCTGGCAGTGGATAAACCAGTCCTTCAATGCCGTGGTCAACTACACCAACAGAAGCGGTGACGCT
CCC
CTCACTGTGAATGAGCTGGGAACGGCTTATGTTTCTGCAACCACTGGCGCTGTGGCAACGGCCCTAG
GA
CTCAATGCCTTAACCAAGCGTGTCTCCCCACTGATAGGACGTTTTGTTCCCTTCGCTGCTGTAGCTGC
T
GCTAACTGCATTAACATCCCACTGATGAGACAAAGGGAGCTGAAGGTTGGTATTCCTGTCACTGATGAA
AAT
GGCACTCGCTTGGGAGAATCGACCAACGCAGCAAAGCAAGCCATCACGCAGGTGGTCATCTCCAGGA
TC
CTCATGGCAGCCCCGGGCATGGCCATCCCTCCGTTTATCATGAACACCTTGGAAAAGAAAGCCTTTTT
A
AAGAGGTTCCCGTGGATGAGTGCGCCAATCCAAGTCACGTTGGTTGGCTTTTGTTTGGTATTCGCCACC
CCC
CTGTGCTGTGCTCTGTTTCCTCAGAAGAGTTCCATGTCTGTGACAAGCTTGGAGGATGAGTTGCAAG
CC
AGCATCCAAAGGACTCATCCTGAAATACGGCGTGTGTACTTTAACAAGGGCCTGTGA


Translation (322 aa):
MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWR
A
KYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFY
RTTPAVLFWQWINQSFNAVVNYTNRSGDA
P
LTV
NELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDE
N
GTRLGESTNAAKQAITQVVISRILMAAPGM
AIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFAT
P
LCCALFPQK
SSMSVTSLEDELQASIQRTHPEIRRVYFNKGL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser