NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26692.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26692.1 Public Mus musculus 13 Lhfpl2 23 108 98 CCDS HistoryNCBI Gene:218454Re-query CCDS DB by CCDS ID:26692.1Re-query CCDS DB by GeneID:218454See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26692.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000054274.7 ENSMUSP00000062239.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054274.7Link to Ensembl Protein Viewer:ENSMUSP00000062239.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000054274Re-query CCDS DB by Protein ID:ENSMUSP00000062239
Original member Current member EBI ENSMUST00000118195.1 ENSMUSP00000112655.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118195.1Link to Ensembl Protein Viewer:ENSMUSP00000112655.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000118195Re-query CCDS DB by Protein ID:ENSMUSP00000112655
Original member Current member EBI ENSMUST00000121618.1 ENSMUSP00000113468.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121618.1Link to Ensembl Protein Viewer:ENSMUSP00000113468.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000121618Re-query CCDS DB by Protein ID:ENSMUSP00000113468
Original member Current member NCBI NM_172589.2 NP_766177.1 Accepted alive Link to Nucleotide Sequence:NM_172589.2Link to Protein Sequence:NP_766177.1Re-query CCDS DB by Nucleotide ID:NM_172589Re-query CCDS DB by Protein ID:NP_766177Link to BLAST:NP_766177.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766177.1 222 Q8BGA2 222 100% 0 0

Chromosomal Locations for CCDS 26692.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 94174224 94174638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 94191848 94192101 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (669 nt):
ATGTGTCATGTCATTGTCACCTGCCGCTCGATGCTCTGGACCCTCCTGAGTATCGTGGTGGCCTTTGCTG
AG
CTCGTTGCCTTCATGAGCGCCGACTGGCTGATCGGGAAAGCCAAGACCCGCAGCGGCAGTGGCGATGA
G
CAGGCAGGCATGAACTCGGAGCCCCACTACCTGGGCATCCTCTGCATCCGTACCCCTGCCATGCAGCAA
GTC
TCTCGGGACACACTGTGCGGGACCTACGCCAAGAGCTTCGGGGAGATAGCCAGCGGCTTCTGGCAGG
CT
ACCGCTATTTTCCTGGCCGTGGGGATCTTCATTCTCTGCGTAGTGGCCTTGGTGTCCGTCTTCACCAT
G
TGCGTGCAAAGCATCATGAGGAAAAGCATTTTCAACGTCTGCGGGCTCCTACAGGGAATCGCAGGTCTG
TTC
CTTATCCTCGGCCTGATCCTCTACCCCGCAGGCTGGGGCTGCCAGAAAGCCATAGACTGTGGACGGT
AT
GCGTCCCCCTACAAACCTGGAGACTGCTCCCTGGGCTGGGCCTTCTATACTGCCACCGGGGGCACGGT
C
CTCACCTTTATCTGTGCTGTCTTCTCTGCACAAGCAGAAATTGCAACCTCCAGTGACAAAGTCCAGGAA
GAA
ATTGAAGAGGGGAAAAACCTCGTCTGCCTCCTTTAA


Translation (222 aa):
MCHVIVTCRSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRSGSGDEQAGMNSEPHYLGILCIRTPAMQQ
V
SRDTLCGTYAKSFGEIASGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIA
GL
F
LILGLILYPAGWGCQKAIDCGRYASPYKPGDCSLGWAFYTATGGTVLTFICAVFSAQAEIATSSDKVQE
E
IEEGKNLVCLL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser