NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26986.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26986.1 Public Mus musculus 14 Lgals3 23 108 98 CCDS HistoryNCBI Gene:16854Re-query CCDS DB by CCDS ID:26986.1Re-query CCDS DB by GeneID:16854See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26986.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000150290.8 ENSMUSP00000114350.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000150290.8Link to Ensembl Protein Viewer:ENSMUSP00000114350.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000150290Re-query CCDS DB by Protein ID:ENSMUSP00000114350
Original member Current member EBI ENSMUST00000142734.7 ENSMUSP00000118169.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000142734.7Link to Ensembl Protein Viewer:ENSMUSP00000118169.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000142734Re-query CCDS DB by Protein ID:ENSMUSP00000118169
Original member Current member EBI ENSMUST00000146468.3 ENSMUSP00000119275.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000146468.3Link to Ensembl Protein Viewer:ENSMUSP00000119275.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000146468Re-query CCDS DB by Protein ID:ENSMUSP00000119275
Original member Current member NCBI NM_001145953.1 NP_001139425.1 Accepted alive Link to Nucleotide Sequence:NM_001145953.1Link to Protein Sequence:NP_001139425.1Re-query CCDS DB by Nucleotide ID:NM_001145953Re-query CCDS DB by Protein ID:NP_001139425Link to BLAST:NP_001139425.1
Original member Current member NCBI NM_010705.3 NP_034835.1 Accepted alive Link to Nucleotide Sequence:NM_010705.3Link to Protein Sequence:NP_034835.1Re-query CCDS DB by Nucleotide ID:NM_010705Re-query CCDS DB by Protein ID:NP_034835Link to BLAST:NP_034835.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139425.1 264 P16110 264 98.1061% 0 5
NP_034835.1 264 P16110 264 98.1061% 0 5

Chromosomal Locations for CCDS 26986.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 47379527 47379544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 47380053 47380418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 47381596 47381684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 47384602 47384767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 47385525 47385680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (795 nt):
ATGGCAGACAGCTTTTCGCTTAACGATGCCTTAGCTGGCTCTGGAAACCCAAACCCTCAAGGATATCCGG
GT
GCATGGGGGAACCAGCCTGGGGCAGGGGGCTACCCAGGGGCTGCTTATCCTGGGGCCTACCCAGGACA
A
GCTCCTCCAGGGGCCTACCCAGGACAGGCTCCTCCAGGGGCCTACCCAGGACAGGCTCCTCCTAGTGCC
TAC
CCCGGCCCAACTGCCCCTGGAGCTTATCCTGGCCCAACTGCCCCTGGAGCTTATCCTGGCTCAACTG
CC
CCTGGAGCCTTCCCAGGGCAACCTGGGGCACCTGGGGCCTACCCCAGTGCTCCTGGAGGCTATCCTGC
T
GCTGGCCCTTATGGTGTCCCCGCTGGACCACTGACGGTGCCCTATGACCTGCCCTTGCCTGGAGGAGTC
ATG
CCCCGCATGCTGATCACAATCATGGGCACAGTGAAACCCAACGCAAACAGGATTGTTCTAGATTTCA
GG
AGAGGGAATGATGTTGCCTTCCACTTTAACCCCCGCTTCAATGAGAACAACAGGAGAGTCATTGTGTG
T
AACACGAAGCAGGACAATAACTGGGGAAAGGAAGAAAGACAGTCAGCCTTCCCCTTTGAGAGTGGCAAA
CCA
TTCAAAATACAAGTCCTGGTTGAAGCTGACCACTTCAAGGTTGCGGTCAACGATGCTCACCTACTGC
AG
TACAACCATCGGATGAAGAACCTCCGGGAAATCAGCCAACTGGGGATCAGTGGTGACATAACCCTCAC
C
AGCGCTAACCACGCCATGATCTAA


Translation (264 aa):
MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSA
Y
PGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPL
TVPYDLPLPGGV
M
PRMLITIMGTVKPNAN
RIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGK
P
FK
IQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser