NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27212.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27212.1 Public Mus musculus 14 Fzd3 23 108 98 CCDS HistoryNCBI Gene:14365Re-query CCDS DB by CCDS ID:27212.1Re-query CCDS DB by GeneID:14365See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27212.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000131309.2 ENSMUSP00000115325.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000131309.2Link to Ensembl Protein Viewer:ENSMUSP00000115325.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000131309Re-query CCDS DB by Protein ID:ENSMUSP00000115325
Original member Current member NCBI NM_021458.2 NP_067433.1 Accepted alive Link to Nucleotide Sequence:NM_021458.2Link to Protein Sequence:NP_067433.1Re-query CCDS DB by Nucleotide ID:NM_021458Re-query CCDS DB by Protein ID:NP_067433Link to BLAST:NP_067433.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067433.1 666 Q61086 666 100% 0 0

Chromosomal Locations for CCDS 27212.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 65202719 65202932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65209692 65209925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65212075 65212223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65234914 65235931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65239718 65239914 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65252944 65253132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2001 nt):
ATGGCTGTGAGCTGGATTGTCTTTGATCTTTGGCTCTTGACTGTGTTTCTGGGGCAGATAGGTGGGCACA
GT
TTGTTTTCTTGTGAACCTATAACCTTGAGGATGTGCCAAGATTTGCCTTACAATACTACCTTCATGCC
T
AATCTTCTGAACCATTATGACCAACAGACTGCAGCTTTAGCAATGGAGCCCTTCCACCCTATGGTGAAC
CTG
GATTGTTCTCGGGATTTTCGGCCATTTCTTTGTGCACTCTATGCCCCTATTTGTATGGAATATGGAC
GT
GTCACACTTCCCTGCCGTAGGCTGTGTCAGCGTGCCTATAGCGAGTGTTCAAAACTCATGGAGATGTT
T
GGTGTCCCGTGGCCTGAAGATATGGAGTGCAGTAGGTTTCCAGATTGTGATGAGCCATATCCCCGACTT
GTG
GATTTGAATTTAGTTGGAGATCCAACTGAAGGAGCCCCAGTTGCAGTGCAGAGGGACTATGGTTTTT
GG
TGTCCCAGAGAGTTAAAAATTGATCCTGATCTTGGCTATTCCTTTCTGCACGTGCGAGATTGTTCGCC
A
CCATGTCCCAATATGTACTTCAGGAGAGAAGAACTGTCATTTGCTCGCTATTTCATAGGCCTGATTTCA
ATC
ATTTGCCTCTCTGCCACATTGTTTACTTTTTTAACCTTTCTAATTGACGTCACAAGATTCCGTTACC
CT
GAAAGACCTATCATATTTTATGCAGTCTGCTACATGATGGTGTCATTAATTTTCTTCATTGGGTTTTT
G
CTGGAGGACCGAGTAGCCTGCAATGCATCTAGCCCTGCACAGTATAAGGCTTCTACAGTGACACAAGGA
TCT
CACAATAAGGCCTGTACCATGCTCTTTATGGTACTATATTTTTTCACTATGGCTGGCAGTGTATGGT
GG
GTAATTCTTACCATCACATGGTTTTTAGCAGCTGTGCCAAAGTGGGGCAGTGAAGCTATTGAGAAGAA
A
GCATTGCTGTTTCATGCCAGTGCCTGGGGCATCCCCGGAACTCTAACTATCATCCTTTTAGCGATGAAT
AAA
ATTGAAGGTGACAATATTAGTGGCGTGTGTTTTGTCGGCCTCTACGACGTTGATGCATTAAGATATT
TC
GTTCTCGCTCCCCTCTGCCTGTATGTGGTAGTTGGGGTTTCTCTCCTTTTAGCCGGCATTATATCCCT
A
AACAGAGTTCGGATTGAGATCCCATTAGAAAAGGAAAACCAAGATAAGTTAGTGAAGTTCATGATCCGG
ATT
GGTGTTTTCAGCATTCTCTACCTTGTGCCACTCTTGGTTGTAATTGGATGTTACTTTTATGAGCAAG
CT
TACCGCGGCATCTGGGAGACAACATGGATCCAGGAACGCTGCAGAGAGTATCACATTCCATGTCCGTA
C
CAGGTTACTCAGATGAGTCGTCCAGACCTGATTCTCTTTCTGATGAAGTATCTCATGGCTCTCATAGTT
GGG
ATTCCCTCTATATTTTGGGTTGGAAGCAAAAAGACATGCTTTGAATGGGCCAGTTTTTTCCATGGGC
GT
AGGAAAAAAGAGATAGTGAATGAGAGCCGGCAGGTGCTCCAGGAACCTGACTTTGCTCAGTCACTCCT
G
AGGGACCCAAATACTCCAATTATAAGAAAATCAAGAGGAACTTCCACTCAAGGGACATCCACACATGCT
TCT
TCAACTCAGCTGGCCATGGTGGATGACCAAAGAAGCAAAGCAGGGAGTGTCCACAGCAAAGTGAGCA
GC
TACCATGGCAGCCTCCACAGGTCACGGGATGGCAGGTACACTCCCTGCAGTTACCGAGGAATGGAGGA
G
AGACTACCTCACGGCAGCATGTCACGGCTGACGGATCATTCCAGGCACAGTAGTTCTCATCGGCTCAAC
GAG
CAGTCCCGACACAGCAGCATCCGAGACCTCAGTAACAACCCCATGACTCACATTACACATGGCACCA
GC
ATGAACCGTGTTATTGAGGAGGATGGAACCAGTGCTTAG


Translation (666 aa):
MAVSWIVFDLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN
L
DCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECS
RFPDCDEPYPRL
V
DLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS
I
ICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQG
S
HNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN
K
IEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
I
GVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQ
VTQMSRPDLILFLMKYLMALIV
G
IPSIFWVGSKKTCFEWASFFHGRRKK
EIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA
S
STQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDG
RYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN
E
QSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser