NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, September 23, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28477.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28477.1 Public Mus musculus 17 Tbc1d24 23 108 98 CCDS HistoryNCBI Gene:224617Re-query CCDS DB by CCDS ID:28477.1Re-query CCDS DB by GeneID:224617See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28477.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000040474.10 ENSMUSP00000036458.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040474.10Link to Ensembl Protein Viewer:ENSMUSP00000036458.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000040474Re-query CCDS DB by Protein ID:ENSMUSP00000036458
Original member Current member EBI ENSMUST00000168378.7 ENSMUSP00000126107.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168378.7Link to Ensembl Protein Viewer:ENSMUSP00000126107.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000168378Re-query CCDS DB by Protein ID:ENSMUSP00000126107
Original member Current member EBI ENSMUST00000171189.7 ENSMUSP00000128001.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171189.7Link to Ensembl Protein Viewer:ENSMUSP00000128001.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000171189Re-query CCDS DB by Protein ID:ENSMUSP00000128001
Original member Current member EBI ENSMUST00000168410.8 ENSMUSP00000128868.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168410.8Link to Ensembl Protein Viewer:ENSMUSP00000128868.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000168410Re-query CCDS DB by Protein ID:ENSMUSP00000128868
Original member Current member EBI ENSMUST00000201960.3 ENSMUSP00000144208.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000201960.3Link to Ensembl Protein Viewer:ENSMUSP00000144208.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000201960Re-query CCDS DB by Protein ID:ENSMUSP00000144208
Original member Current member EBI ENSMUST00000201089.3 ENSMUSP00000144250.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000201089.3Link to Ensembl Protein Viewer:ENSMUSP00000144250.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000201089Re-query CCDS DB by Protein ID:ENSMUSP00000144250
Original member Current member EBI ENSMUST00000202925.3 ENSMUSP00000144575.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000202925.3Link to Ensembl Protein Viewer:ENSMUSP00000144575.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000202925Re-query CCDS DB by Protein ID:ENSMUSP00000144575
Original member Current member NCBI NM_001163850.1 NP_001157322.1 Accepted alive Link to Nucleotide Sequence:NM_001163850.1Link to Protein Sequence:NP_001157322.1Re-query CCDS DB by Nucleotide ID:NM_001163850Re-query CCDS DB by Protein ID:NP_001157322Link to BLAST:NP_001157322.1
Original member Current member NCBI NM_001163851.1 NP_001157323.1 Accepted alive Link to Nucleotide Sequence:NM_001163851.1Link to Protein Sequence:NP_001157323.1Re-query CCDS DB by Nucleotide ID:NM_001163851Re-query CCDS DB by Protein ID:NP_001157323Link to BLAST:NP_001157323.1
Original member Current member NCBI NM_001163852.1 NP_001157324.1 Accepted alive Link to Nucleotide Sequence:NM_001163852.1Link to Protein Sequence:NP_001157324.1Re-query CCDS DB by Nucleotide ID:NM_001163852Re-query CCDS DB by Protein ID:NP_001157324Link to BLAST:NP_001157324.1
Original member Current member NCBI NM_001163853.1 NP_001157325.1 Accepted alive Link to Nucleotide Sequence:NM_001163853.1Link to Protein Sequence:NP_001157325.1Re-query CCDS DB by Nucleotide ID:NM_001163853Re-query CCDS DB by Protein ID:NP_001157325Link to BLAST:NP_001157325.1
Original member Current member NCBI NM_173186.4 NP_775278.3 Accepted alive Link to Nucleotide Sequence:NM_173186.4Link to Protein Sequence:NP_775278.3Re-query CCDS DB by Nucleotide ID:NM_173186Re-query CCDS DB by Protein ID:NP_775278Link to BLAST:NP_775278.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157322.1 555 Q3UUG6-2 555 100% 0 0
NP_001157323.1 555 Q3UUG6-2 555 100% 0 0
NP_001157324.1 555 Q3UUG6-2 555 100% 0 0
NP_001157325.1 555 Q3UUG6-2 555 100% 0 0
NP_775278.3 555 Q3UUG6-2 555 100% 0 0

Chromosomal Locations for CCDS 28477.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 24181241 24181395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24181756 24181984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24182450 24182545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24182786 24182849 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24183694 24183852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 24185204 24186168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1668 nt):
ATGGACCCCCCAGGGTACAATTGCTTTGTGGATAAGGACAAGATGGATGCATCCATCCAGGACCTGGGGC
CA
AAGGAGCTGAACTGCACGGAGCTACAGGAGCTGAAGCAACTGGCACGGCAGGGTTACTGGGCTCAGAG
C
CACACCCTGCGCGGGAAAGTGTACCAGCGCCTGATCCGGGACATCCCCTGCCGCACAGTCACACCTGAT
GCC
AGCGTGTACAGTGACATTGTGGGGAAGATTGTGGGCAAGCACAGCAGCAGTAGTCTGCCCTTGCCTG
AG
TTTGTAGACAACACTCAGGTGCCCACCTACTGCCTGAACACACGGGGTGAAGGGGCTGTGCGCAAGAT
C
CTCCTGTGTATTGCCAACCAGTTCCCTGACATCTCCTTCTGCCCTGCCCTGCCTGCTGTGGTGGCCTTG
CTA
CTGCACTACAGCATCGATGAAGCTGAGTGTTTCGAAAAAGCCTGCCGCATCTTATCCTGCAATGACC
CC
ACCAAGAAGCTCATTGACCAGAGCTTCCTGGCCTTTGAGTCTTCCTGTATGACATTTGGGGACCTGGT
G
AACAAGTACTGCCAGGCAGCCCATAAACTGATGGTGGCCGTGTCAGAGGACGTCCTGCAGGTCTACTCT
GAC
TGGCAGCGATGGCTCTTTGGGGAGCTGCCCCTCAATTACTTTGCCCGTGTTTTTGATGTCTTCCTTG
TA
GAAGGCTACAAAGTATTGTACCGAGTTGCTCTGGCCATCCTCAAGTTCTTCCACAAGGTGAGAGCAGG
A
CAGCCCCTTGAGTCAGACAATGTAAAGCAAGACATCCGAATGTTTGTCAAGGACATTGCCAAGACAGTG
TCC
CCTGAGAAACTACTAGAGAAGGCCTTTGCCATCCGCCTATTTTCCCGAAAGGAGATCCAGCTCTTGC
AA
ATGGCCAATGAGAAAGCACTGAGGCAGAAGGGTATAACTGTCAAACAGAAGAGGCAGTTTGTGCACTT
A
GCTGTCCATGCAGAGAACTTCCACTCAGAGATTGTCAGCGTGAAGGAGATGAGAGACATTTGGTCCTGG
ATC
CCTGAGCGCTTTGCCCTCTGCCAACCCCTCCTGCTCTTCTCATCACTGCAGCATGGGTACAGCCTAA
GC
AGGTTCTATTTCCAGTGTGAAGGACATGAGCCCACCCTCCTGCTCATCAAGACCACTCAAAAGGAGGT
C
TGTGGGGCTTACCTGTCAACAGACTGGAGCGAGAGGACTAAATTCGGAGGCAAGCTGGGCTTCTTTGGG
ACT
GGAGAATGCTTTGTTTTTAGGCTGCAGCCGGAAGTGCAGCGCTATGAGTGGGTGGTCATCAAACACC
CA
GAGCTGACCAAGGCAACATCCCTCAAGTCTTCAGAGGCTGCAGGCAGTTCTTCCCTCATCAGCCACTG
C
TCTTCAGACCCCGCTGATCGGCTCTCCCCTTTCCTGGCTGCCCGGCACTTCAACCTGCCCTCCAAGACT
GAG
TCCATGTTCATGGCTGGAGGCAATGACTGCCTCATCATTGGGGGAGGAGGTGGTCAAGCACTCTACG
TT
GATGGGGACCTGAATCGAGGGCGCACTGGACACTGTGACACATTCAACAACCAGCCCCTCTGCTCTGA
G
AACTTCCTCATCGCAGCTGTGGAGGCTTGGGGCTTCCAAGACCCTGACACCGAATGA


Translation (555 aa):
MDPPGYNCFVDKDKMDASIQDLGPKELNCTELQELKQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPD
A
SVYSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCPALPAVVAL
L
LHYSIDEAECFEKACRILSCNDPTKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYS
D
WQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDNVKQDIRMFVKDIAKTV
S
PEKLLEKAFAIRLFSRKEIQLLQMANEKALRQKGITVKQK
RQFVHLAVHAENFHSEIVSVKEMRDIWSW
I
PERFALCQPLLLFSSLQHGYSLS
RFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERTKFGGKLGFFG
T
GECFVFR
LQPEVQRYEWVVIKHPELTKATSLKSSEAAGSSSLISHCSSDPADRLSPFLAARHFNLPSKT
E
SMFMAGGNDCLII
GGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVEAWGFQDPDTE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser