NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29039.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29039.1 Public Mus musculus 18 Zeb1 23 108 98 CCDS HistoryNCBI Gene:21417Re-query CCDS DB by CCDS ID:29039.1Re-query CCDS DB by GeneID:21417See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29039.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025081.12 ENSMUSP00000025081.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025081.12Link to Ensembl Protein Viewer:ENSMUSP00000025081.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000025081Re-query CCDS DB by Protein ID:ENSMUSP00000025081
Original member Current member NCBI NM_011546.3 NP_035676.1 Accepted alive Link to Nucleotide Sequence:NM_011546.3Link to Protein Sequence:NP_035676.1Re-query CCDS DB by Nucleotide ID:NM_011546Re-query CCDS DB by Protein ID:NP_035676Link to BLAST:NP_035676.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035676.1 1117 Q64318 1117 100% 0 0

Chromosomal Locations for CCDS 29039.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 5591910 5591967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5705043 5705243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5748694 5748855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5758965 5759167 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5761328 5761433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5766221 5768025 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5770384 5770564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 5772429 5773066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3354 nt):
ATGGCGGATGGCCCCAGGTGTAAGCGCAGAAAGCAGGCGAACCCGCGGCGCAATAACGTTACAAATTATA
AT
ACTGTGGTAGAAGCAAATTCAGATTCCGATGATGAAGACAAACTCCATATTGTGGAAGAAGAAAGTAT
T
ACAGATGCAGCTGACTGTGAAGGTGGCATGCCAGATGATGAACTGCCAGCAGACCAGACAGTATTACCA
GGA
GGCAGTGACAGGGGGGGCGGTGCCAAGAACTGCTGGCAAGACAACGTGAAAGACAACGAGTGTGACT
CA
GATGCAGAAAATGAGCAAAACCATGATCCGAATGTGGAAGAATTTCTGCAGCAACAAGACACCGCCGT
C
ATTTATCCTGAGGCGCCCGAGGAAGACCAGCGGCAGGGCACACCAGAAGCCAGCAGTCATGATGAAAAC
G
GA
ACACCAGATGCATTTTCCCAGTTGCTCACCTGCCCGTATTGTGATAGAGGCTACAAGCGCTTTACCT
CT
TTGAAAGAACACATTAAGTACCGCCATGAGAAGAACGAGGACAACTTCAGCTGCTCCCTGTGCAGTTA
C
ACCTTTGCATACAGAACCCAGCTTGAACGTCATATGACATCACATAAGTCAGGAAGAGAGCAAAGACAT
GTG
ACACAGTCTGGGGGAAACCGCAAGTTCAAGTGCACTGAATGCGGGAAGGCCTTCAAGTACAAACACC
AC
CTGAAAGAGCACTTACGGATTCACAGTGGAGAGAAGCCATACGAATGCCCGAACTGCAAGAAACGGTT
T
TCCCATTCTGGCTCCTATAGCTCACATATAAGCAGTAAGAAGTGTATTAGCTTGATGCCTGTGAATGGC
AGG
CCTAGATCAGGACTCAAGACATCTCAGTGTTCCTCGCCATCTCTTTCGACATCACCAGGCAGTCCCA
CA
CGCCCACAGATACGACAGAAGATAGAGAATAAACCCCTTCAAGAACCGCTTTCTGTAAACCAAATCAA
A
ACTGAACCTGTGGATTATGAGTTCAAACCCATAGTGGTTGCTTCAGGAATCAACTGTTCAACCCCTTTA
CAA
AATGGGGTTTTTAGCAGTGGTGGCCAATTGCAGGCAACCAGTTCTCCTCAGGGTGTGGTGCAAGCCG
TT
GTTCTGCCAACAGTTGGTTTGGTATCTCCCATAAGTATCAACTTAAGTGACATTCAGAATGTACTTAA
A
GTGGCTGTAGATGGTAACGTAATACGACAAGTCTTGGAGACTAATCAAGCCAGTCTTGCATCCAAAGAG
CAA
GAAGCAGTGAGTGCTTCGCCCATCCAGCAGGGTGGCCATTCTGTCATTTCTGCCATCAGTCTTCCTT
TA
GTTGATCAGGATGGAACAACCAAAATCATCATCAACTACAGTCTTGAGCAGCCCAGTCAACTTCAGGT
T
GTTCCCCAGAATTTAAAGAAAGAAATCCCAGCCCCTACAAACAGCTGCAAAAGTGAGAAGTTACCAGAA
GAC
CTTACTGTCAAATCAGAAACGGACAAAAGCTTTGAGGGGGCCAGGGATGATAGCACTTGCCTTCTGT
GT
GAGGACTGCCCAGGGGACCTCAATGCACTTCCAGAACTAAAGCACTATGACCCAGAGTGCCCTGCTCA
G
CCTCCACCCCCTGCCCCAGCCACCGAGAAGCCAGAGTCCTCTGCTTCATCAGCTGGAAACGGAGATTTG
TCT
CCCAGTCAGCCACCTTTAAAGAACCTTCTGTCACTCTTGAAAGCCTACTATGCTCTGAACGCGCAGC
CA
AGCACAGAAGAGCTCTCAAAGATCGCCGATTCTGTGAACCTACCGCTGGATGGAGTTAAAAAGTGGTT
T
GAAAAGATGCAAGCTGGACAGATTCCAGGACAGTCTCCTGACCCCCCTTCTCCTGGAACCGGGTCAGTA
AAC
ATACCTACAAAAACCGATGAGCAGCCTCAACCTGCGGATGGAAATGAGCCCCAGGAAGACAGCACAC
GC
GGACAGAGTCCTGTCAAGATAAGGAGCTCTCCGGTTTTACCTGTAGGATCAGCCATGAACGGTTCCAG
A
AGCTGCACATCATCCCCATCCCCTCTAAACCTTTGCTCAGCCAGGAACCCGCAGGGTTACTCTTGTGTG
GCA
GAGGGTGCCCAGGAGGAGCCCCAAGTAGAACCTCTTGATCTCTCACTACCAAAGCAACAGGGAGAGT
TA
CTGGAAAGGTCGACAGTCAGTAGCGTTTACCAGAACAGTGTTTATTCTGTCCAGGAAGAACCCTTGAA
C
TTGTCTTGTGCAAAAAAGGAACCACAAAAGGACAGCTGTGTTACAGACTCAGAACCAGTTGTAAATGTA
GTC
CCACCAAGTGCCAACCCCATAAACATTGCTATTCCTACAGTCACTGCCCAGTTACCCACAATCGTGG
CC
ATTGCTGACCAGAACAGTGTTCCATGTTTAAGAGCACTGGCCGCCAACAAGCAGACTATTCTGATTCC
C
CAAGTGGCATATACATATTCAGCTACTGTGAGCCCTGCCGTGCAGGAGCCGCCAGTGAAGGTGATCCAG
CCA
AACGGAAACCAGGATGAAAGACAAGACACTAGCTCAGAAGGAGTCTCCACTGTGGAGGACCAGAATG
AC
TCTGACTCCACGCCACCCAAAAAGAAAACTCGGAAGACAGAGAATGGAATGTATGCATGTGACCTGTG
T
GACAAGATATTTCAGAAGAGCAGCTCACTGTTGAGACACAAATATGAGCACACAGGTAAGAGGCCTCAC
GAG
TGTGGAATCTGTAGAAAGGCATTTAAACACAAGCATCATTTGATTGAGCACATGCGGCTGCACTCTG
GG
GAAAAGCCCTATCAATGTGACAAGTGTGGCAAGCGCTTCTCACACTCCGGCTCCTACTCTCAACACAT
G
AATCACCGCTACTCCTACTGCAAGAGAGGAGCTGAAGACAGAGATGCTATGGAGCAGGAAGACGCTGGG
CCC
GAAGTCCTGCCGGAAGTCCTGGCGACTGAGCATGTTGGTGCCCGGGCGTCTCCCTCACAGGCTGACT
CG
GACGAGAGAGAAAGTCTGACAAGGGAAGAAGATGAAGACAGTGAAAAGGAGGAGGAGGAGGAAGATAA
A
GAGATGGAAGAATTACAGGAAGGAAAGGAATGTGAGAACCCACAGGGGGAGGAGGAGGAGGAGGAGGAG
GAG
GAAGAGGAGGAAGAAGAGGAGGAAGAGGAGGAAGTGGAAGCGGATGAAGCCGAGCATGAGGCAGCAG
CC
AAGACTGATGGTACAGTGGAGGTTGGAGCTGCACAGCAGGCAGGCAGCTTAGAGCAGAAGGCCAGCGA
G
AGCGAGATGGAGAGCGAAAGCGAGAGTGAGCAGCTGTCTGAAGAGAAGACAAATGAAGCTTAG


Translation (1117 aa):
MADGPRCKRRKQANPRRNNVTNYNTVVEANSDSDDEDKLHIVEEESITDAADCEGGMPDDELPADQTVLP
G
GSDRGGGAKNCWQDN
VKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPEEDQRQGTPEASSHDEN
G
TPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRH
V
TQSGGNRKFKCTECGKAFKYKHHLKEHLRIHS
GEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNG
R
PRSGLKTSQCSSPSLSTSPGSPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVVASGINCSTPL
Q
NGVFSSGGQLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLETNQASLASKE
Q
EAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEIPAPTNSCKSEKLPE
D
LTVKSETDKSFEGARDDSTCLLCEDCPGDLNALPELKHYDPECPAQPPPPAPATEKPESSASSAGNGDL
S
PSQPPLKNLLSLLKAYYALNAQPSTEELSKIADSVNLPLDGVKKWFEKMQAGQIPGQSPDPPSPGTGSV
N
IPTKTDEQPQPADGNEPQEDSTRGQSPVKIRSSPVLPVGSAMNGSRSCTSSPSPLNLCSARNPQGYSCV
A
EGAQEEPQVEPLDLSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNV
V
PPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSATVSPAVQEPPVKVIQ
P
NGNQ
DERQDTSSEGVSTVEDQNDSDSTPPKKKTRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPH
E
CGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKRGAEDRDAMEQEDAG
P
EVLPEVLATEHVGARASPSQADSDERESLTREEDEDSEKEEEEEDKEMEELQEGKECENPQGEEEEEEE
E
EEEEEEEEEEEVEADEAEHEAAAKTDGTVEVGAAQQAGSLEQKASESEMESESESEQLSEEKTNEA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser