NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29261.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29261.1 Public Mus musculus 18 Lmnb1 23 108 98 CCDS HistoryNCBI Gene:16906Re-query CCDS DB by CCDS ID:29261.1Re-query CCDS DB by GeneID:16906See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29261.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025486.8 ENSMUSP00000025486.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025486.8Link to Ensembl Protein Viewer:ENSMUSP00000025486.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000025486Re-query CCDS DB by Protein ID:ENSMUSP00000025486
Original member Current member NCBI NM_010721.2 NP_034851.2 Accepted alive Link to Nucleotide Sequence:NM_010721.2Link to Protein Sequence:NP_034851.2Re-query CCDS DB by Nucleotide ID:NM_010721Re-query CCDS DB by Protein ID:NP_034851Link to BLAST:NP_034851.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034851.2 588 P14733 588 100% 0 0

Chromosomal Locations for CCDS 29261.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 56708113 56708474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56728401 56728557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56729287 56729412 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56730970 56731140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56733212 56733337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56739821 56740041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56740687 56740912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56743211 56743315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56747977 56748096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56749699 56749809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 56752607 56752648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1767 nt):
ATGGCGACCGCGACCCCCGTGCAGCAGCAGCGGGCGGGCAGCCGCGCCAGCGCCCCCGCCACGCCGCTCA
GC
CCCACGCGCCTGTCGCGCCTGCAGGAGAAAGAGGAGCTGCGGGAGCTCAACGACCGCCTGGCTGTGTA
C
ATCGATAAGGTGCGCAGCCTGGAGACGGAGAACAGCGCGCTGCAGCTGCAGGTGACCGAGCGCGAGGAG
GTG
CGCGGCCGCGAGCTCACCGGCCTCAAGGCTCTCTACGAGACCGAGCTGGCCGACGCACGCCGCGCTC
TG
GACGACACGGCCCGCGAGCGCGCCAAGCTCCAGATCGAGCTGGGCAAGTTCAAGGCCGAGCACGACCA
G
CTGCTGCTCAATTATGCCAAGAAGGAATCTGATCTCAGTGGAGCCCAGATCAAGCTTCGAGAGTATGAG
GCG
GCACTAAACTCTAAGGATGCGGCGCTGGCTACTGCCCTAGGGGACAAAAAGAGTTTAGAGGGAGACT
TG
GAGGATCTGAAAGATCAGATTGCCCAGCTAGAAGCATCCTTATCTGCCGCCAAAAAGCAGTTAGCAGA
T
GAAACTTTACTTAAAGTGGATTTGGAGAATCGCTGTCAGAGCCTTACTGAGGACTTGGAGTTTCGTAAA
AAT
ATGTATGAAGAGGAGATCAATGAGACAAGGAGGAAGCATGAGACCCGCTTGGTGGAAGTGGACTCTG
GG
CGTCAGATTGAGTATGAGTACAAGCTGGCTCAAGCCCTGCATGAGATGCGGGAGCAGCACGACGCGCA
G
GTGAGGCTGTACAAGGAAGAGCTGGAGCAGACCTACCACGCCAAGCTTGAGAATGCCAGACTCTCCTCA
GAG
ATGAACACTTCCACTGTCAACAGTGCCCGGGAAGAGCTGATGGAGAGCCGGATGAGGATCGAGAGCC
TC
TCCTCACAGCTCTCTAACCTGCAGAAAGAGTCTAGAGCGTGTTTGGAAAGGATCCAGGAATTGGAGGA
C
ATGCTTGCTAAGGAGAGAGACAACTCGCGCCGCATGCTGTCTGACAGAGAGAGAGAGATGGCGGAGATC
AGG
GACCAGATGCAGCAGCAGCTGAGTGATTATGAGCAGCTGCTGGACGTGAAGCTGGCCCTGGACATGG
AG
ATCAGCGCCTACAGGAAGCTCCTGGAAGGCGAAGAAGAGCGGTTAAAGCTCTCTCCAAGCCCTTCTTC
C
CGGGTGACCGTGTCCAGAGCGTCCTCCAGTCGCAGTGTGCGCACCACCAGAGGAAAGCGGAAGAGAGTT
GAT
GTGGAGGAGTCGGAGGCGAGCAGCAGTGTTAGCATTTCCCACTCTGCCTCAGCCACGGGGAACGTGT
GC
ATTGAAGAGATAGATGTTGATGGGAAGTTTATTCGCTTGAAGAACACTTCTGAGCAGGATCAACCAAT
G
GGAGGCTGGGAGATGATCAGAAAAATTGGAGACACATCAGTCAGTTACAAATATACCTCAAGATATGTG
CTG
AAGGCTGGCCAGACTGTCACAGTGTGGGCTGCAAATGCTGGCGTCACAGCCAGCCCTCCAACTGACC
TC
ATCTGGAAGAACCAGAACTCTTGGGGTACTGGTGAAGATGTGAAGGTTATATTGAAGAATTCTCAGGG
A
GAGGAGGTTGCTCAGAGAAGCACAGTCTTCAAGACCACCATACCCGAGGAGGAGGAGGAGGAGGAGGAG
GAG
CCCATCGGAGTGGCTGTGGAGGAGGAGCGTTTCCACCAGCAGGGAGCCCCAAGAGCATCCAATAAAA
GC
TGTGCCATTATGTGA


Translation (588 aa):
MATATPVQQQRAGSRASAPATPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREE
V
RGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLL
NYAKKESDLSGAQIKLREYE
A
ALNSKDAALATALGDKKSLEGDLEDLKDQIAQ
LEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRK
N
MYEE
EINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSS
E
MNTSTVNSAREELMESRMRIESLSSQLSNLQKE
SRACLERIQELEDMLAKERDNSRRMLSDREREMAEI
R
DQMQQQLSDYEQLLDVKLALDMEISAYRKLLEGEEE
RLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRV
D
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQ
DQPMGGWEMIRKIGDTSVSYKYTSRYV
L
KAGQTVT
VWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEE
E
PIGVAVEEERFHQQ
GAPRASNKSCAIM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser