NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS30466.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30466.1 Public Mus musculus X Maged2 23 108 98 CCDS HistoryNCBI Gene:80884Re-query CCDS DB by CCDS ID:30466.1Re-query CCDS DB by GeneID:80884See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30466.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000026302.12 ENSMUSP00000026302.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026302.12Link to Ensembl Protein Viewer:ENSMUSP00000026302.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000026302Re-query CCDS DB by Protein ID:ENSMUSP00000026302
Original member Current member EBI ENSMUST00000112697.9 ENSMUSP00000108317.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112697.9Link to Ensembl Protein Viewer:ENSMUSP00000108317.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000112697Re-query CCDS DB by Protein ID:ENSMUSP00000108317
Original member Current member EBI ENSMUST00000112699.8 ENSMUSP00000108319.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112699.8Link to Ensembl Protein Viewer:ENSMUSP00000108319.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000112699Re-query CCDS DB by Protein ID:ENSMUSP00000108319
Original member Current member EBI ENSMUST00000112700.7 ENSMUSP00000108320.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112700.7Link to Ensembl Protein Viewer:ENSMUSP00000108320.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000112700Re-query CCDS DB by Protein ID:ENSMUSP00000108320
Original member Current member NCBI NM_001199246.2 NP_001186175.1 Accepted alive Link to Nucleotide Sequence:NM_001199246.2Link to Protein Sequence:NP_001186175.1Re-query CCDS DB by Nucleotide ID:NM_001199246Re-query CCDS DB by Protein ID:NP_001186175Link to BLAST:NP_001186175.1
Original member Current member NCBI NM_001358566.1 NP_001345495.1 Accepted alive Link to Nucleotide Sequence:NM_001358566.1Link to Protein Sequence:NP_001345495.1Re-query CCDS DB by Nucleotide ID:NM_001358566Re-query CCDS DB by Protein ID:NP_001345495Link to BLAST:NP_001345495.1
Original member Current member NCBI NM_001358567.1 NP_001345496.1 Accepted alive Link to Nucleotide Sequence:NM_001358567.1Link to Protein Sequence:NP_001345496.1Re-query CCDS DB by Nucleotide ID:NM_001358567Re-query CCDS DB by Protein ID:NP_001345496Link to BLAST:NP_001345496.1
Original member Current member NCBI NM_001358568.1 NP_001345497.1 Accepted alive Link to Nucleotide Sequence:NM_001358568.1Link to Protein Sequence:NP_001345497.1Re-query CCDS DB by Nucleotide ID:NM_001358568Re-query CCDS DB by Protein ID:NP_001345497Link to BLAST:NP_001345497.1
Original member Current member NCBI NM_030700.3 NP_109625.1 Accepted alive Link to Nucleotide Sequence:NM_030700.3Link to Protein Sequence:NP_109625.1Re-query CCDS DB by Nucleotide ID:NM_030700Re-query CCDS DB by Protein ID:NP_109625Link to BLAST:NP_109625.1

Chromosomal Locations for CCDS 30466.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 150806717 150807181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150807572 150807686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150808721 150808783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150809110 150809152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150809247 150809326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150809703 150809797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150810344 150810423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150810681 150810744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150810874 150811182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150811823 150812314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 150812671 150812715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1851 nt):
ATGTCTGACACAAGCGAGAGTGGTGCAGATCCAGCTCGCTCTCAGGGCAAAGCTTCAGAAAAGGACAGCG
GC
TCCGTGATGCAGGACCTGTTGACCGTGACCCAGAACTTGGAGGTCTCAGAAACACCAAAGGCAGAAAA
G
GCACCAGAGGTTTCAGAGGCTGCAAAGGCTCCAAAAGCCTCTGGGAACCCAAAGGCGACAGAGGTCTCA
AAG
GCCCCAGAGGCGTCTGAGGCAGCTGCCACCCAGGCCTCACCTACCACACAGCTGAGTGAGACCCAAG
TT
CTGGCAACTGAAAACAAGAGTCCAGCAGCTGACACCAAGACGCAGAAGTCTGACCTGCAGGCTATGAC
A
ATGCCTACAACCCCGACCAAAAAGGTCAGCTGTGGTACCGATCCAAAGGTCAATACAAAGGCTCCGGAG
ACT
GAGGCTCCTGCCTCTCAGGCTGGGACAGATGAACCAGAGCCTGAGGGTACAGCTGTCCAGGTTCAGG
AG
AACCAGGATACTCGGCCCAAGGTCAAAGCCAAGAATACCCAAAAGGGGAAACACCCGGATGGAGAAGA
G
GATGGCAACAGTGACCAGAGTCAGGCTTCAGAAGCCACAGGTGGTCGAAGGGTCTCAAAGGCCCTAATG
GCC
TCCATGGCTCGCAGAGCTTCAAGGGGACCCATAGCCTTTTGGGCCCGCAGGGCATCAAGGACTCGGT
TG
GCTGCCTGGGCTCGGAGAGCTTTGCTCTCCCTGAGGTCACCTAGAGCTCGCAGAGGCAAGGCCCGAAG
A
AGAGCTGCGAAGCTACAGTCATCCCAGGAACCTGAGGCACCCCCACCCAGAGATGTGGCCCTTTTACAA
GGA
AGGGCAAATGACTTGGTGAAGTACCTGTTGGCTAAAGACCAGACAAAGATTCCCATCAGACGCTCAG
AT
ATGCTGAAGGACATCATCAAAGAATATACTGATGTATACCCTGAAATCATTGAACGAGCAGGCTATTC
C
TTGGAGAAGGTATTTGGAATCCAATTGAAAGAAATTGACAAGAATGACCACTTGTATATTCTTCTCAGT
ACC
TTAGAGCCAACTGATGCAGGCATATTGGGAACGACCAAGGACTCACCTAAGCTGGGCCTCCTCATGG
TG
CTTCTTAGCATCATCTTCATGAATGGAAATCGGTCCAGTGAGGCTGTCATCTGGGAGGTGCTGCGCAA
G
TTGGGGCTGCGCCCTGGGATTCATCACTCACTCTTTGGAGATGTGAAGAAACTCATTACTGATGAGTTT
GTG
AAGCAGAAGTACCTGGACTATGCCAGAGTACCCAATAGCAATCCTCCTGAGTACGAGTTCTTCTGGG
GC
CTACGCTCTTACTATGAGACCAGCAAGATGAAAGTTCTCAAGTTTGCTTGTAAGGTGCAAAAGAAGGA
T
CCCAAGGAATGGGCAGCTCAGTACCGAGAGGCAATGGAAGCAGATTTGAAGGCTGCAGCTGAGGCTGCT
GCC
GAAGCCAAGGCGAGGGCTGAGATTAGAGCTCAGATGGGCATTGGGCTTGGCTCTGAGAATGCCGCTG
GG
CCCTGCAACTGGGACGAAGCTGATATTGGACCCTGGGCAAAGGCCCGGATCCAGGCAGGAGCTGAAAC
T
AAAGCCAAAGCCCAAGGAAGTGGTGGTGCCAATGCCAGTGCTGGTGCCGGTGCCAGTACTGGTACCAGT
GTT
GGTGCCAGTGGCAGTGCCAGTGCTGGTGCCAGTGCTGGTGCCAGTGGTGGCTTCAGTAACAACTCCA
GC
CTGACTGCCAGTCTCACATTTGGGCTCTTCGCTGGCCTTAGTGGAGCTGGGGCCAGTACCAACAGCAG
C
TCTGGTGCCTGTGGTTTCTCCTACAAGTGA


Translation (616 aa):
MSDTSESGADPARSQGKASEKDSGSVMQDLLTVTQNLEVSETPKAEKAPEVSEAAKAPKASGNPKATEVS
K
APEASEAAATQASPTTQLSETQVLATENKSPAADTKTQKSDLQAMTMPTTPTKKVSCGTDPKVNTKAPE
T
EAPASQAGTDEPEPEGTAVQVQENQDTRPKVKAKNTQK
GKHPDGEEDGNSDQSQASEATGGRRVSKALM
A
SMARRASRGPIAFWARRASRTRLAAWARRALLSLRSPRARRGKARRRAAKLQSSQEPEAPPPRDVALLQ
G
R
ANDLVKYLLAKDQTKIPIRRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLS
T
LEPTDAGILG
TTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
V
KQ
KYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAMEADLKAAAEAA
A
EAKARAEIRAQMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAETKAKAQGSGGANASAGAGASTGTS
V
GASGSASAGASAGASGGFSNNSSLTASLTFGLFAGLSGAGASTNSSSGACGFSYK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser