NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34610.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34610.1 Public Homo sapiens 7 GPNMB 22 109 92 CCDS HistoryNCBI Gene:10457Re-query CCDS DB by CCDS ID:34610.1Re-query CCDS DB by GeneID:10457See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34610.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381990.6 ENSP00000371420.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381990.6Link to Ensembl Protein Viewer:ENSP00000371420.2Re-query CCDS DB by Nucleotide ID:ENST00000381990Re-query CCDS DB by Protein ID:ENSP00000371420
Original member NCBI NM_001005340.1 NP_001005340.1 Updated not alive Link to Nucleotide Sequence:NM_001005340.1Link to Protein Sequence:NP_001005340.1Re-query CCDS DB by Nucleotide ID:NM_001005340Re-query CCDS DB by Protein ID:NP_001005340
Current member NCBI NM_001005340.2 NP_001005340.1 Accepted alive Link to Nucleotide Sequence:NM_001005340.2Link to Protein Sequence:NP_001005340.1Re-query CCDS DB by Nucleotide ID:NM_001005340Re-query CCDS DB by Protein ID:NP_001005340Link to BLAST:NP_001005340.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001005340.1 572 Q14956-1 572 100% 0 0

Chromosomal Locations for CCDS 34610.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 23246858 23246927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23253307 23253459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23254169 23254312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23256892 23257065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23259980 23260138 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23260456 23260773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23266481 23266615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23267886 23267988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23269967 23270175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23273521 23273614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 23274065 23274224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1719 nt):
ATGGAATGTCTCTACTATTTCCTGGGATTTCTGCTCCTGGCTGCAAGATTGCCACTTGATGCCGCCAAAC
GA
TTTCATGATGTGCTGGGCAATGAAAGACCTTCTGCTTACATGAGGGAGCACAATCAATTAAATGGCTG
G
TCTTCTGATGAAAATGACTGGAATGAAAAACTCTACCCAGTGTGGAAGCGGGGAGACATGAGGTGGAAA
AAC
TCCTGGAAGGGAGGCCGTGTGCAGGCGGTCCTGACCAGTGACTCACCAGCCCTCGTGGGCTCAAATA
TA
ACATTTGCGGTGAACCTGATATTCCCTAGATGCCAAAAGGAAGATGCCAATGGCAACATAGTCTATGA
G
AAGAACTGCAGAAATGAGGCTGGTTTATCTGCTGATCCGTATGTTTACAACTGGACAGCATGGTCAGAG
GAC
AGTGACGGGGAAAATGGCACCGGCCAAAGCCATCATAACGTCTTCCCTGATGGGAAACCTTTTCCTC
AC
CACCCCGGATGGAGAAGATGGAATTTCATCTACGTCTTCCACACACTTGGTCAGTATTTCCAGAAATT
G
GGACGATGTTCAGTGAGAGTTTCTGTGAACACAGCCAATGTGACACTTGGGCCTCAACTCATGGAAGTG
ACT
GTCTACAGAAGACATGGACGGGCATATGTTCCCATCGCACAAGTGAAAGATGTGTACGTGGTAACAG
AT
CAGATTCCTGTGTTTGTGACTATGTTCCAGAAGAACGATCGAAATTCATCCGACGAAACCTTCCTCAA
A
GATCTCCCCATTATGTTTGATGTCCTGATTCATGATCCTAGCCACTTCCTCAATTATTCTACCATTAAC
TAC
AAGTGGAGCTTCGGGGATAATACTGGCCTGTTTGTTTCCACCAATCATACTGTGAATCACACGTATG
TG
CTCAATGGAACCTTCAGCCTTAACCTCACTGTGAAAGCTGCAGCACCAGGACCTTGTCCGCCACCGCC
A
CCACCACCCAGACCTTCAAAACCCACCCCTTCTTTAGCAACTACTCTAAAATCTTATGATTCAAACACC
CCA
GGACCTGCTGGTGACAACCCCCTGGAGCTGAGTAGGATTCCTGATGAAAACTGCCAGATTAACAGAT
AT
GGCCACTTTCAAGCCACCATCACAATTGTAGAGGGAATCTTAGAGGTTAACATCATCCAGATGACAGA
C
GTCCTGATGCCGGTGCCATGGCCTGAAAGCTCCCTAATAGACTTTGTCGTGACCTGCCAAGGGAGCATT
CCC
ACGGAGGTCTGTACCATCATTTCTGACCCCACCTGCGAGATCACCCAGAACACAGTCTGCAGCCCTG
TG
GATGTGGATGAGATGTGTCTGCTGACTGTGAGACGAACCTTCAATGGGTCTGGGACGTACTGTGTGAA
C
CTCACCCTGGGGGATGACACAAGCCTGGCTCTCACGAGCACCCTGATTTCTGTTCCTGACAGAGACCCA
GCC
TCGCCTTTAAGGATGGCAAACAGTGCCCTGATCTCCGTTGGCTGCTTGGCCATATTTGTCACTGTGA
TC
TCCCTCTTGGTGTACAAAAAACACAAGGAATACAACCCAATAGAAAATAGTCCTGGGAATGTGGTCAG
A
AGCAAAGGCCTGAGTGTCTTTCTCAACCGTGCAAAAGCCGTGTTCTTCCCGGGAAACCAGGAAAAGGAT
CCG
CTACTCAAAAACCAAGAATTTAAAGGAGTTTCTTAA


Translation (572 aa):
MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWK
N
SWK
GGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSE
D
SDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL
GQYFQKLGRCSVRVSVNTANVTLGPQLMEV
T
VYRRHGRAYVPIAQVKDVYVVT
DQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTIN
Y
KWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSL
ATTLKSYDSNT
P
GPAGDNPLELSRIPDENCQINRYGHFQATITIV
EGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
P
TEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDR
DP
A
SPLRMANSALISVGCLAIFVTVISLLVY
KKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKD
P
LLKNQEFKGVS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser