NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36719.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36719.1 Public Mus musculus 13 Fastkd3 23 108 98 CCDS HistoryNCBI Gene:69577Re-query CCDS DB by CCDS ID:36719.1Re-query CCDS DB by GeneID:69577See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36719.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000051784.9 ENSMUSP00000061737.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051784.9Link to Ensembl Protein Viewer:ENSMUSP00000061737.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000051784Re-query CCDS DB by Protein ID:ENSMUSP00000061737
Original member Current member NCBI NM_001330423.1 NP_001317352.1 Accepted alive Link to Nucleotide Sequence:NM_001330423.1Link to Protein Sequence:NP_001317352.1Re-query CCDS DB by Nucleotide ID:NM_001330423Re-query CCDS DB by Protein ID:NP_001317352Link to BLAST:NP_001317352.1
Original member Current member NCBI NM_027123.5 NP_081399.3 Accepted alive Link to Nucleotide Sequence:NM_027123.5Link to Protein Sequence:NP_081399.3Re-query CCDS DB by Nucleotide ID:NM_027123Re-query CCDS DB by Protein ID:NP_081399Link to BLAST:NP_081399.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001317352.1 661 Q8BSN9-1 661 100% 0 0
NP_081399.3 661 Q8BSN9-1 661 100% 0 0

Chromosomal Locations for CCDS 36719.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 68583562 68585002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68585178 68585263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68587660 68587834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68589320 68589389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68590106 68590220 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68591931 68592029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1986 nt):
ATGGCGTTCATCACCCTGCGGAGGGCCTTTTGTCATAAGTCCATTCTTTGGATACCTGGAGCTGTGGTTG
CT
CTGAAAATTCACCCTGCCAGTCATGCCCCAAAGGCAGTCACAGATCGCCTGAGTGTGTGCTTCTGCTC
C
CTACAACCTGAGCTGTTCAGGGTCAGATTCCATCACGCATACTGTAAAAACTTCCACTCAGAAAAGGGA
AAT
GACTTTCATCCCGTGGGCGAGCCATGGTCCTCCCAGGCGCAGGAATGGAACCAGCCAGGACAGAGTC
TT
CAAAACGAGGATGAAGAGATGCTTTTCAGGAGACTAAGCTACTTCACTTCCTTTGAGGAAGTGCTGAG
T
TTCATAAGTGCCCTGGACACCCTGCCTGTCCCTCTGGCAATGGCAGCTCTACTCAGGATCTGTGAGATA
GGG
AGGAGGGATGGTGAGCAAAGGCTGCCAGAAGGAGTGCTGGAGAACCGTGCCTTCCAGGCTCTTTGCC
TC
CGGTGTGAGCGAGACCCCTCACACCTGACCAATGCTGGTTTGGTGACAGCTTTGCAATCTCTGCTTAC
G
TTGTTGCCTGCAGATCCTCAAAGTAGCCTGATGCTGAGCCTGGTGGCAGAATGCCAACGTCGTCTCCAA
AGA
GGCAACCTCGAAGTCCACCATCTTTGTGTCCTTGGGGAAAGTCTGGCCATGCTTCAAGGTGCGAGTT
GT
GAGACCCTGAAGCTGGTTGTCCGTCAACTTCAAAGTAAAAGTGTGGAAACATTTGCTCCAGAGGAGAT
C
ACGTCCGTTTATAGGATTCTGCAGGTGTGTCCTGAAGAAGTAGACAAACACCAGATGTTCTTAAACACA
TTA
AACAACTTCTCCATTTCAGTAGTTCCCTACCTGAGCCCTAAATCCATTAGCCATGTCCTCACCGCCT
TA
GTGGCCCTGGACCAGACTCACGCACTCCCACTGCTTATAAAGCTGGGCAAGTACGTTGTGAGATACAT
C
CCCCGTTTTACCAACGAAGAGCTCAGGAAGGTCTTGGAGGCGTTTGTCTATTTCGGACACAGTGACAGG
TTC
TTCACAGAGGCCTTAGAGCAACATGTGTCCGCCCTGTGCTTCTCCCTGGACCCCGCTGTGGCCAGCT
CC
GTGATGGGGTACTGCAGCAGGAAACGGATTCTCTCCAAGCCCATCTTCGACGTAGTCTCAGAGATCGT
T
GTTTGCCAGTGGGACAGACTTTCACCTAGTCAGATTGCCGAGCTAATTGAGCCATTTGGAAAGCTCAAT
TAC
GTGCCACCAAACGCCCCTGCCCTGTTTAGGAAGGTAGAAAATGTGCTCTGTGCCCGTTTACATCACT
TC
CCACCAAAGATGCTACTGAGGCTCCTTCATTCATGTGCGCTGATTGAGCGACATCCCGTCAACTTCAT
G
TCAAAACTATTCAGCCCCTTTTTCCTTCAGCGGCTGCAAGGTAAAGAGTCATATTTGGACAGATTGAGC
CTG
GCACAGCTGACCCAACTTTTCCTAACCTCCGTCCTAGAGTGTCCGTTCTATAAGGGCCCCAAACTTC
TT
CCTAAATATCAAGTGAAGTCATTTCTCACTCCATGCTGCTCCTTAGAGACGCCCCTGGATCTCCATCT
G
TATAAGTCTGTGGTGATTGGACTGATTGATCTTTTAGGATCAAGACTGTATTTTGCTTCAAAGGTGTTG
ACG
CCCTATTACTACACTATAGATGTTGAAGTTAAATTAGATGAAGATGGATTTGTATTGCCGTGTACAG
TG
GATGAGGATATCCACAAAAGGGTGGCGCTGTGTATTGATGGGCCACAGCGATTTTGCTTGGACAGTAA
A
CACTTACTTGGAAAAGAGGCTACTAAGCAGAGACACCTGCGGTTACTTGGTTACCAGGTTGTTCAGCTT
CCC
TATCATGAGCTGGAGCTGCTTACATCAAGACTTGAGTTGGTGGACTATTTACAAAGGAAGCTGTTTT
CT
CAAAGCTCCGCTGTCCACTGGTAA


Translation (661 aa):
MAFITLRRAFCHKSILWIPGAVVALKIHPASHAPKAVTDRLSVCFCSLQPELFRVRFHHAYCKNFHSEKG
N
DFHPVGEPWSSQAQEWNQPGQSLQNEDEEMLFRRLSYFTSFEEVLSFISALDTLPVPLAMAALLRICEI
G
RRDGEQRLPEGVLENRAFQALCLRCERDPSHLTNAGLVTALQSLLTLLPADPQSSLMLSLVAECQRRLQ
R
GNLEVHHLCVLGESLAMLQGASCETLKLVVRQLQSKSVETFAPEEITSVYRILQVCPEEVDKHQMFLNT
L
NNFSISVVPYLSPKSISHVLTALVALDQTHALPLLIKLGKYVVRYIPRFTNEELRKVLEAFVYFGHSDR
F
FTEALEQHVSALCFSLDPAVASSVMGYCSRKRILSKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLN
Y
VPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQRLQ
GKESYLDRLS
L
AQLTQLFLTSVLECPFYK
GPKLLPKYQVKSFLTPCCSLETPLDLHLYKSVVIGLIDLLGSRLYFASKVL
T
PYYYTI
DVEVKLDEDGFVLPCTVDEDIHKRVALCIDGPQRFCLDSKHLLGKEATKQRHLRLLGYQVVQL
P
YHELELLTSRLELVDYLQRKLFSQSSAVHW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser