NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37215.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37215.1 Public Mus musculus 15 Acvrl1 23 108 98 CCDS HistoryNCBI Gene:11482Re-query CCDS DB by CCDS ID:37215.1Re-query CCDS DB by GeneID:11482See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37215.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000000542.13 ENSMUSP00000000542.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000542.13Link to Ensembl Protein Viewer:ENSMUSP00000000542.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000000542Re-query CCDS DB by Protein ID:ENSMUSP00000000542
Original member Current member EBI ENSMUST00000120754.1 ENSMUSP00000112490.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120754.1Link to Ensembl Protein Viewer:ENSMUSP00000112490.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000120754Re-query CCDS DB by Protein ID:ENSMUSP00000112490
Original member Current member EBI ENSMUST00000120028.7 ENSMUSP00000113297.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120028.7Link to Ensembl Protein Viewer:ENSMUSP00000113297.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000120028Re-query CCDS DB by Protein ID:ENSMUSP00000113297
Original member Current member EBI ENSMUST00000117984.7 ENSMUSP00000113505.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117984.7Link to Ensembl Protein Viewer:ENSMUSP00000113505.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000117984Re-query CCDS DB by Protein ID:ENSMUSP00000113505
Original member Current member EBI ENSMUST00000119063.7 ENSMUSP00000113536.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000119063.7Link to Ensembl Protein Viewer:ENSMUSP00000113536.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000119063Re-query CCDS DB by Protein ID:ENSMUSP00000113536
Original member Current member EBI ENSMUST00000121718.7 ENSMUSP00000114027.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121718.7Link to Ensembl Protein Viewer:ENSMUSP00000114027.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000121718Re-query CCDS DB by Protein ID:ENSMUSP00000114027
Original member Current member NCBI NM_001277257.1 NP_001264186.1 Accepted alive Link to Nucleotide Sequence:NM_001277257.1Link to Protein Sequence:NP_001264186.1Re-query CCDS DB by Nucleotide ID:NM_001277257Re-query CCDS DB by Protein ID:NP_001264186Link to BLAST:NP_001264186.1
Original member Current member NCBI NM_001277258.1 NP_001264187.1 Accepted alive Link to Nucleotide Sequence:NM_001277258.1Link to Protein Sequence:NP_001264187.1Re-query CCDS DB by Nucleotide ID:NM_001277258Re-query CCDS DB by Protein ID:NP_001264187Link to BLAST:NP_001264187.1
Original member Current member NCBI NM_001277259.1 NP_001264188.1 Accepted alive Link to Nucleotide Sequence:NM_001277259.1Link to Protein Sequence:NP_001264188.1Re-query CCDS DB by Nucleotide ID:NM_001277259Re-query CCDS DB by Protein ID:NP_001264188Link to BLAST:NP_001264188.1
Original member Current member NCBI NM_009612.3 NP_033742.2 Accepted alive Link to Nucleotide Sequence:NM_009612.3Link to Protein Sequence:NP_033742.2Re-query CCDS DB by Nucleotide ID:NM_009612Re-query CCDS DB by Protein ID:NP_033742Link to BLAST:NP_033742.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001264186.1 502 Q61288 502 100% 0 0
NP_001264187.1 502 Q61288 502 100% 0 0
NP_001264188.1 502 Q61288 502 100% 0 0
NP_033742.2 502 Q61288 502 100% 0 0

Chromosomal Locations for CCDS 37215.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 101134680 101134743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101135298 101135543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101135749 101135960 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101136128 101136227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101136984 101137130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101137364 101137639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101138208 101138405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101141067 101141197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101143343 101143477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1509 nt):
ATGACCTTGGGGAGCTTCAGAAGGGGCCTTTTGATGCTGTCGGTGGCCTTTGGCCTAACCAGGGGAGACT
TG
GCGAAGCCTTCCAAGCTGGTGAACTGCACTTGTGAGAGCCCACACTGCAAGAGACCATTCTGCCAGGG
G
TCATGGTGCACAGTGGTGCTGGTTCGGGAGCAGGGCAGGCACCCCCAGGTCTATCGGGGCTGCGGGAGC
CTG
AACCAGGAGCTCTGCTTGGGACGTCCCACAGAGTTTCTGAACCATCACTGCTGCTATAGATCCTTCT
GC
AACCACAACGTGTCTCTGATGCTGGAGGCCACCCAAACTCCTTCGGAGGAGCCAGAAGTTGATGCCCA
T
CTGCCTCTGATCCTGGGTCCTGTGCTGGCCTTGCCGGTCCTGGTGGCCCTGGGTGCTCTAGGCTTGTGG
CGT
GTCCGGCGGAGGCAGGAGAAGCAGCGGGATTTGCACAGTGACCTGGGCGAGTCCAGTCTCATCCTGA
AG
GCATCTGAACAGGCAGACAGCATGTTGGGGGACTTCCTGGACAGCGACTGTACTACGGGCAGCGGCTC
G
GGGCTCCCCTTCTTGGTGCAGAGGACGGTAGCTCGGCAGGTTGCGCTGGTAGAGTGTGTGGGAAAGGGC
CGA
TATGGTGAGGTGTGGCGCGGTTCGTGGCATGGCGAGAGTGTGGCGGTCAAGATTTTCTCCTCACGAG
AT
GAGCAGTCCTGGTTCCGGGAGACGGAGATCTACAACACAGTTCTGCTTAGACACGACAACATCCTAGG
C
TTCATCGCCTCCGACATGACTTCGCGGAACTCGAGCACGCAGCTGTGGCTCATCACCCACTACCATGAA
CAC
GGCTCCCTCTATGACTTTCTGCAGAGGCAGACGCTGGAGCCCCAGTTGGCCCTGAGGCTAGCTGTGT
CC
GCGGCCTGCGGCCTGGCGCACCTACATGTGGAGATCTTTGGCACTCAAGGCAAACCAGCCATTGCCCA
T
CGTGACCTCAAGAGTCGCAATGTGCTGGTCAAGAGTAACTTGCAGTGTTGCATTGCAGACCTGGGACTG
GCT
GTGATGCACTCACAAAGCAGCGATTACCTGGATATCGGCAACAACCCCCGAGTGGGTACCAAAAGAT
AC
ATGGCACCCGAGGTGCTGGATGAGCACATCCGCACAGACTGCTTTGAGTCGTACAAGTGGACAGACAT
C
TGGGCCTTTGGCCTAGTGCTATGGGAGATCGCCCGGCGGACCATCATCAATGGCATTGTGGAGGATTAC
AGG
CCACCTTTCTATGACATGGTACCCAATGACCCCAGTTTTGAGGACATGAAAAAGGTGGTGTGCGTTG
AC
CAGCAGACACCCACCATCCCTAACCGGCTGGCTGCAGATCCGGTCCTCTCCGGGCTGGCCCAGATGAT
G
AGAGAGTGCTGGTACCCCAACCCCTCTGCTCGCCTCACCGCACTGCGCATAAAGAAGACATTGCAGAAG
CTC
AGTCACAATCCAGAGAAGCCCAAAGTGATTCACTAG


Translation (502 aa):
MTLGSFRRGLLMLSVAFGLTRGDLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGS
L
NQELCLGRPTEFLNHHCCYRSFCNHNVSLMLE
ATQTPSEEPEVDAHLPLILGPVLALPVLVALGALGLW
R
VRRRQEKQRDLHSDLGESSLILKASEQADSMLG
DFLDSDCTTGSGSGLPFLVQRTVARQVALVECVGKG
R
YGEVWRGSWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNIL
GFIASDMTSRNSSTQLWLITHYHE
H
GSLYDFLQRQTLEPQLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADL
GL
A
VMHSQSSDYLDIGNNPRVGTKRYMAPEVLDEHIRTDCFESYKWTDIWAFGLVLWEIARRTIIN
GIVEDY
R
PPFYDMVPNDPSFEDMKKVVCVDQQTPTIPNRLAADP
VLSGLAQMMRECWYPNPSARLTALRIKKTLQK
L
SHNPEKPKVIH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser