NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37801.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37801.1 Public Mus musculus 18 Dpysl3 23 108 98 CCDS HistoryNCBI Gene:22240Re-query CCDS DB by CCDS ID:37801.1Re-query CCDS DB by GeneID:22240See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37801.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025379.13 ENSMUSP00000025379.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025379.13Link to Ensembl Protein Viewer:ENSMUSP00000025379.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000025379Re-query CCDS DB by Protein ID:ENSMUSP00000025379
Original member Current member NCBI NM_009468.5 NP_033494.1 Accepted alive Link to Nucleotide Sequence:NM_009468.5Link to Protein Sequence:NP_033494.1Re-query CCDS DB by Nucleotide ID:NM_009468Re-query CCDS DB by Protein ID:NP_033494Link to BLAST:NP_033494.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033494.1 570 Q62188 570 100% 0 0

Chromosomal Locations for CCDS 37801.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 43324332 43324420 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43325725 43325887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43328325 43328504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43329691 43329861 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43332872 43333013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43333881 43334037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43342242 43342362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43345106 43345174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43353881 43353961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43354743 43354804 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43358234 43358398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43360962 43361146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43363503 43363591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 43392990 43393028 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1713 nt):
ATGTCCTACCAGGGCAAGAAGAACATTCCGCGGATCACGAGTGACCGTCTTCTAATCAAGGGAGGGAGAA
TC
GTCAATGATGATCAGTCCTTTTATGCTGATATTTACATGGAGGATGGCTTAATAAAGCAAATTGGAGA
C
AATCTGATTGTCCCCGGAGGTGTGAAGACCATCGAGGCCAACGGGAAGATGGTGATCCCTGGAGGCATT
GAC
GTCCATACCCACTTCCAGATGCCTTACAAGGGAATGACCACAGTGGACGATTTCTTCCAAGGGACAA
AG
GCTGCCTTAGCGGGAGGCACCACCATGATCATTGACCACGTGGTACCTGAACCTGAGTCTAGCCTGAC
A
GAGGCCTATGAAAAGTGGCGTGAGTGGGCCGATGGGAAGAGCTGCTGTGACTATGCTTTGCATGTGGAC
ATC
ACCCACTGGAATGACAGCGTCAAGCAGGAGGTACAGAGCCTCAGCAAGGAAAAAGGCGTTAACTCCT
TC
ATGGTTTACATGGCCTACAAGGATTTATATCAAGTGTCCAACACAGAGCTCTATGAGATCTTCACCTG
C
CTGGGAGAGCTGGGGGCCATTGCTCAAGTTCATGCCGAGAATGGAGATATCATTGCCCAGGAGCAGGCA
CGG
ATGCTGGAAATGGGGATAACCGGCCCAGAAGGCCACGTTCTGAGCAGACCGGAAGAGCTGGAAGCTG
AG
GCTGTGTTCCGTGCCATCACCGTCGCCAGCCAGACCAACTGCCCCCTCTATGTCACCAAGGTCATGAG
C
AAGAGCGCGGCTGATCTCATCTCACAAGCCAGGAAGAAAGGAAATGTGGTCTTTGGCGAGCCCATCACT
GCC
AGCCTGGGAATAGATGGAACTCATTACTGGAGTAAGAACTGGGCCAAAGCAGCTGCGTTTGTGACAT
CC
CCACCTCTGAGCCCTGACCCTACCACACCTGACTACATCAACTCCTTGCTGGCCAGCGGGGATCTGCA
G
CTCTCTGGAAGTGCCCACTGTACCTTTAGCACTGCCCAGAAAGCCATTGGGAAGGACAACTTCACAGCC
ATC
CCTGAAGGCACCAATGGCGTGGAGGAGCGTATGTCTGTCATCTGGGACAAGGCTGTGGCCACGGGGA
AG
ATGGATGAAAACCAGTTTGTGGCCGTGACAAGCACCAATGCTGCCAAGATATTCAACCTGTACCCTCG
A
AAGGGGAGAATAGCTGTGGGCTCTGACAGCGACCTTGTCATCTGGGATCCAGATGCCTTGAAGATTGTC
TCT
GCCAAGAACCACCAGTCGGTTGCCGAATACAACATCTTTGAAGGGATGGAGCTGCGTGGTGCACCTC
TG
GTGGTTATCTGCCAGGGCAAGATCATGCTGGAAGATGGCAACCTGCACGTGACCCAGGGGGCTGGCCG
C
TTCATTCCCTGCAGCCCATTCTCTGACTATGTCTATAAGCGCATTAAAGCAAGGAGGAAGATGGCAGAC
CTG
CATGCAGTCCCAAGAGGCATGTATGATGGACCAGTGTTTGACTTGACCACCACCCCCAAGGGGGGCA
CC
CCAGCTGGCTCTACTCGGGGCTCTCCCACTCGGCCAAACCCGCCAGTGAGGAACCTCCATCAGTCAGG
A
TTTAGCCTGTCAGGCACCCAAGTGGATGAGGGTGTCCGCTCAGCTAGCAAACGCATTGTGGCACCCCCT
GGA
GGCCGTTCTAACATCACATCCCTGAGTTAA


Translation (570 aa):
MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGI
D
VHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMI
IDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVD
I
THWNDSVKQEVQSLSKEK
GVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQA
R
MLEMGITGPEGHVLSRPEE
LEAEAVFRAITVASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPIT
A
SLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLA
SGDLQLSGSAHCTFSTAQKAIGKDNFTA
I
PEGTNGVEERMSVIWDKAV
ATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDSDLVIWDPDALKIV
S
AKNHQS
VAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMAD
L
HAVPRGMYDGPVFDLTTTPKGGTPAGSTRGSPTRPNPPVRNLHQSGFSLS
GTQVDEGVRSASKRIVAPP
G
GRSNITSLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser