NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37923.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37923.1 Public Mus musculus 19 Ms4a1 23 108 98 CCDS HistoryNCBI Gene:12482Re-query CCDS DB by CCDS ID:37923.1Re-query CCDS DB by GeneID:12482See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37923.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000169159.2 ENSMUSP00000126422.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169159.2Link to Ensembl Protein Viewer:ENSMUSP00000126422.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000169159Re-query CCDS DB by Protein ID:ENSMUSP00000126422
Original member Current member NCBI NM_007641.6 NP_031667.1 Accepted alive Link to Nucleotide Sequence:NM_007641.6Link to Protein Sequence:NP_031667.1Re-query CCDS DB by Nucleotide ID:NM_007641Re-query CCDS DB by Protein ID:NP_031667Link to BLAST:NP_031667.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031667.1 291 P19437 291 100% 0 0

Chromosomal Locations for CCDS 37923.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11251665 11251883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11253179 11253280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11254455 11254691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11256573 11256632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11258133 11258252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11258684 11258821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (876 nt):
ATGAGTGGACCTTTCCCAGCAGAGCCTACAAAAGGTCCCCTCGCCATGCAACCTGCTCCAAAAGTGAACC
TC
AAAAGGACATCTTCACTGGTGGGCCCCACACAAAGCTTCTTCATGAGGGAATCAAAGGCTTTGGGGGC
T
GTCCAAATCATGAATGGCCTCTTCCATATTACCCTGGGGGGACTGCTGATGATCCCCACAGGGGTCTTC
GCA
CCCATCTGTTTGAGTGTATGGTACCCTCTCTGGGGAGGCATTATGTACATTATTTCAGGATCACTCC
TG
GCAGCTGCAGCAGAAAAAACCTCCAGGAAGAGTTTGGTCAAAGCAAAAGTGATAATGAGCTCTCTAAG
C
CTCTTTGCTGCCATTTCTGGAATAATTCTTTCAATCATGGACATACTTAACATGACACTTTCTCATTTT
TTA
AAAATGAGAAGACTGGAGCTTATTCAAACTTCCAAGCCGTATGTTGATATCTACGACTGTGAACCAT
CT
AATTCCTCAGAGAAAAACTCCCCATCTACACAGTACTGTAACAGCATTCAGTCTGTGTTCTTGGGCAT
T
CTGTCGGCGATGCTGATCTCTGCCTTCTTCCAGAAACTTGTGACAGCTGGTATTGTGGAGAATGAGTGG
AAA
AGAATGTGTACCAGATCCAAATCTAATGTGGTTCTGCTGTCAGCTGGAGAAAAAAATGAGCAGACGA
TT
AAAATGAAAGAAGAAATCATTGAGCTAAGTGGAGTATCTTCCCAACCAAAGAATGAAGAGGAAATTGA
A
ATTATTCCAGTGCAGGAGGAAGAAGAAGAAGAAGCAGAAATAAATTTTCCAGCACCTCCCCAAGAGCAG
GAA
TCCTTGCCAGTGGAAAATGAGATCGCTCCTTAA


Translation (291 aa):
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLGGLLMIPTGVF
A
PICLSVWYPLWGGIM
YIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFAAISGIILSIMDILNMTLSHF
L
KMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFL
GILSAMLISAFFQKLVTAGIVENEW
K
RMCTRSKS
NVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQ
E
SLPVENEIAP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser