NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37956.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37956.1 Public Mus musculus 19 Gldc 23 108 98 CCDS HistoryNCBI Gene:104174Re-query CCDS DB by CCDS ID:37956.1Re-query CCDS DB by GeneID:104174See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37956.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025778.8 ENSMUSP00000025778.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025778.8Link to Ensembl Protein Viewer:ENSMUSP00000025778.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000025778Re-query CCDS DB by Protein ID:ENSMUSP00000025778
Original member Current member NCBI NM_138595.2 NP_613061.1 Accepted alive Link to Nucleotide Sequence:NM_138595.2Link to Protein Sequence:NP_613061.1Re-query CCDS DB by Nucleotide ID:NM_138595Re-query CCDS DB by Protein ID:NP_613061Link to BLAST:NP_613061.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_613061.1 1025 Q91W43 1025 100% 0 0

Chromosomal Locations for CCDS 37956.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 30098967 30099110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30099837 30099917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30100743 30100915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30102979 30103074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30110673 30110784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30113722 30113863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30115188 30115300 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30116399 30116548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30118543 30118668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30124722 30124797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30131672 30131814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30133480 30133521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30133695 30133779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30134190 30134287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30136504 30136584 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30137093 30137232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30139275 30139380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30143360 30143456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30145147 30145343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30145618 30145765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30147169 30147246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30151422 30151586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30158514 30158649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30174424 30174502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 30174991 30175260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3078 nt):
ATGCAGCTGTGTGCCAGGGCATGGGGGCTGCGCCTGGGCCGCGGAGCCGGGGGCGGCCACCGCCTGGCTC
GG
GGCACCGGCTTGAGTTGGGCGCAGCGAAGCCGGGACAGCAGCGGCGGCGGTGGCGGTGGCGGTGGCGG
G
GACCGCGGCGCGGCTGGGGCCTCGCGCCTTCTGGAGCGCCTCCTGCCCAGACACGATGACTTCTCCCGG
AGA
CACATCGGCCCCGGAGACAAAGACCGGAGGGAGATGCTGCAGGCGCTGGGGCTGGCGAGCATTGATG
AG
CTCATCGAGAAGACGGTCCCCGCCAGCATCCGCTTGAAGAGACCCTTGAAAATGGAAGACCCTATTTG
T
GAGAATGAAATCCTCGAGACTCTGCATGCCATTGCAAGCAAGAACCAGATCTGGAGGTCGTATATTGGC
ATG
GGCTATTACAACTGCTCGGTGCCCCAGACCATTTTGCGGAACTTACTGGAGAATTCTGGATGGGTCA
CC
CAGTACACTCCGTATCAGCCAGAGGTGTCCCAGGGGAGGCTGGAGAGTTTACTCAACTACCAGACCAT
G
GTGTCTGACATCACAGGCTTGGACATGGCCAACGCTTCCCTGCTGGATGAGGCAACCGCGGCTGCAGAG
GCG
ATGCAACTGTGCCACAGACACAACAAGAGGAAGAAATTTTTCGTTGATCCTCGTTGTCACCCACAGA
CG
ATAGCTGTTGTCCAGACTCGAGCCAAATATAGGGGGGTGCTTGTCGAGCTGAAGTTACCCCACGAAAT
G
GATTTCAGTGGCAAAGACGTCTGTGGGGTGCTGTTCCAGTACCCAGACACTGAGGGGAAGGTGGAGGAC
TTC
ACAGAACTTGTAGACAGAGCCCATCAGACTGGGAGCCTGACCTGCTGTGCTACTGACCTTTTAGCTC
TG
TGTATTTTGAGGCCACCTGGAGAGTTTGGAGTGGACATTGCCCTGGGCAACTCCCAGAGATTTGGAGT
G
CCACTGGGCTATGGGGGACCGCATGCGGCCTTCTTTGCTGTCAAAGAAAACCTGGTGAGGATGATGCCT
GGA
AGGATGGTGGGGGTGACAAGGGATGCCACAGGGAAGGAAGTGTATCGCCTCGCTCTCCAGACCAGAG
AA
CAACACATCCGGAGAGACAAAGCCACCAGCAACATCTGCACGGCTCAGGCCCTTTTAGCCAACATGGC
T
GCCATGTTCGCCATTTACCATGGATCCCAGGGGCTGAAGCACATTGCTAAAAGGGTTCATAATGCTACT
TTG
ATTTTGTCTGAAGGGCTCAAGCGAGCAGGACACCAACTCCAGCATGACCTGTTCTTTGACACTTTGA
AG
GTTCAGTGTGGCTGCTCAGTGAAGGAGGTGCTGGGCAGAGCAGCTCAGAGGCAAATCAACTTTCGACT
C
TTCGATGACGGCACACTTGGCATTTCTTTGGATGAAACAGTCACTGAGAAAGATCTGGATGATTTACTG
TGG
ATCTTCGGCTGTGAGTCATCTGCAGAATTAGTTGCTGAAGGCATGGGAGAGGAGCGGAGAGGTCTTC
TA
GGGTCTTCATTCAAGAGAACCAGCCCGTTCCTCACTCATCAGGTGTTCAACAGCTATCACTCAGAAAC
T
AATCTTGTCCGGTATATGAAGAAACTGGAGAACAAAGACATCTCCCTCGTTCACAGCATGATCCCACTG
GGA
TCCTGCACCATGAAGCTCAATAGCTCCTCCGAACTTGCACCCATCACCTGGAGAGAATTTGCCAACA
TC
CACCCCTTTGTGCCGCTGGACCAAGCCCAGGGATACCAACAGCTTTTCCAAGGGCTGGAGAAGGATCT
G
TGTGAGATCACAGGCTACGACCGAGTCTCATTCCAGCCAAACAGCGGAGCGCAGGGGGAGTACGCCGGA
CTG
GCCACCATCAGAGCGTACTTAGACCAGAAAGGAGAGAGACACAGAACAGTCTGTCTCATTCCTAAGT
CA
GCACATGGAACGAATCCAGCAAGCGCTCACATGGCGGGCATGAAGATCCAGCCTGTGGAGGTGGACAG
A
TACGGGAACATCGATGTGGCTCACCTCAAGGCCATGGTGGACCAACACAAGGAGAACCTGGCCGCCATC
ATG
ATCACGTATCCATCTACCAATGGTGTATTTGAAGAGAATATCGGCGATGTGTGCGCCCTGATTCACC
AA
CACGGAGGACAGGTCTACCTCGACGGGGCGAACATGAATGCCCAGGTGGGAATCTGCCGCCCTGGGGA
C
TTTGGGTCAGACGTCTCTCACCTAAATCTTCACAAGACCTTCTGCATTCCCCACGGAGGGGGCGGTCCT
GGC
ATGGGGCCCATCGGAGTGAAGAAGCACCTCAGCCCCTTTCTGCCCAGCCACCCCGTCATTTCCATAA
AG
CCAACTGAAGGCACCTGGCCCGTGGGCACTGTCAGTGCAGCCCCGTGGGGTTCCAGCTCCATCCTGCC
C
ATTTCATGGGCTTACATTAAGATGATGGGTGGAAAGGGCCTCAAAGAAGCCACAGAAATCGCCATTCTA
AAT
GCCAACTACATGGCCAAACGACTAGAGAAACACTACAGAGTCCTCTTTAGAGGTGCAAGAGGGTATG
TG
GCTCATGAGTTTATCTTGGACACCCGACCCTTCAAAAAGTCTGCCAATGTTGAGGCTGTGGATGTTGC
C
AAGAGGCTCCAGGATTATGGATTTCACGCCCCTACCATGTCCTGGCCTGTGGCAGGGACTCTCATGATT
GAG
CCCACCGAGTCAGAAGACAAGGCAGAGCTCGACAGATTCTGTGATGCTATGATCAGCATCAGGCAAG
AA
ATCGCTGACATAGAGGAGGGCCGCATCGACCCGAGGGTCAACCCCCTGAAGATGTCTCCACACTCCTT
G
ACCTGTGTCACATCCTCCTGCTGGGATCGGCCGTATTCTAGAGAGGTAGCAGCATTTCCACTGCCCTTT
GTG
AAACCAGAGAACAAATTCTGGCCAACCATTGCCCGGATCGATGACATCTACGGAGATCAGCACTTGG
TC
TGCACCTGCCCGCCCATGGAGGTCTATGAGTCTCCATTTTCTGAACAGAAGAGGGCTTCTTCTTAG


Translation (1025 aa):
MQLCARAWGLRLGRGAGGGHRLARGTGLSWAQRSRDSSGGGGGGGGGDRGAAGASRLLERLLPRHDDFSR
R
HIGPGDKDRREMLQALGLA
SIDELIEKTVPASIRLKRPLKMEDPICENEILETLHAIASKNQIWRSYIG
M
GYYNCSVPQTILRNLLENSG
WVTQYTPYQPEVSQGRLESLLNYQTMVSDITGLDMANASLLDEATAAAE
A
MQLCH
RHNKRKKFFVDPRCHPQTIAVVQTRAKYRGVLVELKLPHEMDFSGKDVCGVLFQYPDTEGKVED
F
TELVDRAHQTG
SLTCCATDLLALCILRPPGEFGVDIALGNSQRFGVPLGYGGPHAAFFAVKENLVRMMP
G
RMVGVT
RDATGKEVYRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSQGLKHIAKRVHNAT
L
ILSE
GLKRAGHQLQHDLFFDTLKVQCGCSVKEVLGRAAQRQINFRLFDDGTLGISLDETVTEKDLDDLL
W
IFGCESSA
ELVAEGMGEERRGLLGSSFKRTSPFLTHQVFNSYHSETNLVRYMKKLENKDISLVHSMIPL
G
SCTMKLNSSSELA
PITWREFANIHPFVPLDQAQGYQQLFQGLEKDLCEITGYDRVSFQPNSGAQGEYAG
L
ATIRAYLDQKGERHRT
VCLIPKSAHGTNPASAHMAGMKIQPVEVDRYGNIDVAHLKAMVDQHKENLAAI
M
ITYPSTNGVFEENIGDVCALIHQHGGQVYLDGANMNAQ
VGICRPGDFGSDVSHLNLHKTFCIPHGGGGP
G
MGPIG
VKKHLSPFLPSHPVISIKPTEGTWPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKEATEIAIL
N
ANYMAKRLEKHYRVLFRGAR
GYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFHAPTMSWPVAGTLMI
E
PTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLK
MSPHSLTCVTSSCWDRPYSREVAAFPLPF
V
KPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser