NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40262.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40262.1 Public Mus musculus 8 Gm6040 23 108 98 CCDS HistoryNCBI Gene:100503992Re-query CCDS DB by CCDS ID:40262.1Re-query CCDS DB by GeneID:100503992See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40262.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000095430.3 ENSMUSP00000093080.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095430.3Link to Ensembl Protein Viewer:ENSMUSP00000093080.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000095430Re-query CCDS DB by Protein ID:ENSMUSP00000093080
Original member Current member NCBI NM_001025353.2 NP_001020524.1 Accepted alive Link to Nucleotide Sequence:NM_001025353.2Link to Protein Sequence:NP_001020524.1Re-query CCDS DB by Nucleotide ID:NM_001025353Re-query CCDS DB by Protein ID:NP_001020524Link to BLAST:NP_001020524.1

Chromosomal Locations for CCDS 40262.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 20917011 20917147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 20917637 20917691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (192 nt):
ATGAGACTCCATGGTTTCTTCTTGGCTCTCTTTGCCGTCTTCCAGGTACTGCACGCTATCAGCAGTGCAC
TC
AATTTTGAAAGACCTTGCTACCTCCGAGGAGGTATCTGCCTGAAGCAGGGGACACCAAACTGTGAGCC
T
TTCAGAGGACCCTGCAGAGCTTTCACTGTCTGCTGCAAAATAAGAAGTTGA


Translation (63 aa):
MRLHGFFLALFAVFQVLHAISSALNFERPCYLRGGICLKQGTPNCEPFRGPCRAFTVCCKIRS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser