NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, October 26, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40263.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40263.1 Public Mus musculus 8 AY761185 23 108 98 CCDS HistoryNCBI Gene:100503970Re-query CCDS DB by CCDS ID:40263.1Re-query CCDS DB by GeneID:100503970See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40263.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000110758.3 ENSMUSP00000106386.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110758.3Link to Ensembl Protein Viewer:ENSMUSP00000106386.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000110758Re-query CCDS DB by Protein ID:ENSMUSP00000106386
Original member Current member NCBI NM_001012640.2 NP_001012658.1 Accepted alive Link to Nucleotide Sequence:NM_001012640.2Link to Protein Sequence:NP_001012658.1Re-query CCDS DB by Nucleotide ID:NM_001012640Re-query CCDS DB by Protein ID:NP_001012658Link to BLAST:NP_001012658.1

Chromosomal Locations for CCDS 40263.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 20943857 20943969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 20944539 20944710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (285 nt):
ATGAAGACACTCGTTCTCCTCTCTGCCCTTGTCCTGCTGGCCTTCTATGTCCAGGCTGATTCTACCCAAG
AG
ACTGATGAAGAGACTAAAACTGATGATCAGCCAGGGGAAGAGGATCAGGGTGTGTCTGTCTCCTTTGA
A
GACCCAGAACGCTATGTTCTTCAAGTTTCAGGCCTAGGAAAGCCTCCCCAGTGCCCGAAGTGCCCAGTG
TGC
TCAAAGTGCCCACAGTGCCCACAGTGCCCACAGTGCCCGGGGTGCCCGAGGTGCAATTGCATGACAA
AA
TGA


Translation (94 aa):
MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPERYVLQVSGLGKPPQCPKCPV
C
SKCPQCPQCPQCPGCPRCNCMTK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser