NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40282.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40282.1 Public Mus musculus 8 Defb1 23 108 98 CCDS HistoryNCBI Gene:13214Re-query CCDS DB by CCDS ID:40282.1Re-query CCDS DB by GeneID:13214See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40282.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000051017.8 ENSMUSP00000051754.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051017.8Link to Ensembl Protein Viewer:ENSMUSP00000051754.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000051017Re-query CCDS DB by Protein ID:ENSMUSP00000051754
Original member Current member NCBI NM_007843.3 NP_031869.1 Accepted alive Link to Nucleotide Sequence:NM_007843.3Link to Protein Sequence:NP_031869.1Re-query CCDS DB by Nucleotide ID:NM_007843Re-query CCDS DB by Protein ID:NP_031869Link to BLAST:NP_031869.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031869.1 69 P56386 69 100% 0 0

Chromosomal Locations for CCDS 40282.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 21776652 21776712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 21794428 21794576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (210 nt):
ATGAAAACTCATTACTTTCTCCTGGTGATGATATGTTTTCTTTTCTCCCAGATGGAGCCAGGTGTTGGCA
TT
CTCACAAGTCTTGGACGAAGAACAGATCAATACAAATGCCTTCAACATGGAGGATTCTGTCTCCGCTC
C
AGCTGCCCATCTAATACCAAACTACAGGGAACCTGTAAACCAGATAAGCCCAACTGTTGTAAGAGCTGA


Translation (69 aa):
MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser