NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40292.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40292.1 Public Mus musculus 8 Alg11 23 108 98 CCDS HistoryNCBI Gene:207958Re-query CCDS DB by CCDS ID:40292.1Re-query CCDS DB by GeneID:207958See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40292.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000110737.2 ENSMUSP00000106365.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110737.2Link to Ensembl Protein Viewer:ENSMUSP00000106365.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000110737Re-query CCDS DB by Protein ID:ENSMUSP00000106365
Original member Current member NCBI NM_183142.4 NP_898965.1 Accepted alive Link to Nucleotide Sequence:NM_183142.4Link to Protein Sequence:NP_898965.1Re-query CCDS DB by Nucleotide ID:NM_183142Re-query CCDS DB by Protein ID:NP_898965Link to BLAST:NP_898965.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_898965.1 450 Q3TZM9-2 450 100% 0 0

Chromosomal Locations for CCDS 40292.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 22060727 22060770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 22061886 22062116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 22065126 22065931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 22067881 22068152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1353 nt):
ATGGCGGCGGACACTGGGAGCTGGTGCGTGTACGCCGTGCTGCGGTTTTTCTATTCACTCTTCTTTCCTG
GA
CTGATGATATGCGGAGTTTTGTGTGTATATTTGGTCATTGGCCTTTGGGTTATCAGGTGGCATCTACA
G
AGAAAGAAGAAGTCTGTGTCGACCAGCAAAAATGGAAAAGAACAAACGGTGGTTGCATTTTTCCATCCA
TAC
TGTAATGCAGGTGGCGGAGGAGAGAGAGTTCTGTGGTGTGCTTTGAGAGCCCTGCAGAAAAAGAAAC
GC
TACCTTGTGGAAGATTCCCGGTATCCTCACTTCACATTGCTAGGCCAAAGTCTTGGATCCATTCTTCT
C
GGCTGGGAAGCTCTGATGCAGCGCGTTCCTGATGTTTACATCGACTCAATGGGATACGCCTTCACACTC
CCT
CTCTTTAAGTATGTGGGAGGTTGCCGAGTCGGAAGCTATGTTCACTATCCCACGATCAGCACTGACA
TG
CTGTCTGTGGTGAAGAATCAGAATCCTGGATTTAATAATGCTGCTTTCATTAGCAGAAATGCTCTTCT
C
AGCAAAGCAAAGCTCATCTATTACTATTTATTTGCTTTTGTTTATGGCCTTGTTGGATCTTGCAGTGAC
ATA
GTCATGGTTAATTCTTCTTGGACATTAAACCATATCCTCTCACTGTGGAAGGTTGGGCATTGCACTA
AC
ATTGTCTATCCACCTTGTGATGTGCAGACATTTCTGGACATCCCTTTACATGAGAAGAAGGTGACCCC
A
GGGCATTTGCTGGTTTCCATTGGCCAGTTCAGACCTGAAAAGAATCATGCTTTGCAGATCAAAGCCTTT
GCT
AAATTGTTAAATGAGAAAGCAGCTGAGTTAGGCCATTCTCTTAAACTTGTCCTTATTGGAGGGTGTC
GC
AACAAAGATGATGAGTTTAGAGTAAACCAACTGAGAAGTCTATCTGAGAATTTGGGAGTTCAAGAAAA
T
GTGGAATTTAAAATAAACATTTCATTCGATGAATTGAAGAATTACTTGTCTGAAGCGACCATCGGTCTG
CAT
ACTATGTGGAATGAGCATTTTGGGATTGGAGTTGTCGAGTGTATGGCAGCTGGCACAGTTATCCTTG
CA
CACAACTCAGGAGGCCCGAAGCTGGACATTGTCATTCCTCATGAAGGACAGATAACTGGCTTTCTGGC
T
GAGAGTGAAGAAGGCTATGCTGACTCTATGGCTCACATTCTTTCTCTGTCTGCAGAAGAGAGACTCCAA
ATC
AGGAAGAATGCTAGAGCGTCTATAAGCAGATTCTCCGACCAGGAGTTTGAAGTAGCATTCCTGTGTT
CC
ATGGAGAAGTTACTTACTTAG


Translation (450 aa):
MAADTGSWCVYAVLRFFYSLFFPGLMICGVLCVYLVIGLWVIRWHLQRKKKSVSTSKNGKEQTVVAFFHP
Y
CNAGGGGERVLWCALRALQK
KKRYLVEDSRYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAFTL
P
LFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAFISRNALLSKAKLIYYYLFAFVYGLVGSCSD
I
VMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTPGHLLVSIGQFRPEKNHALQIKAF
A
KLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSLSENLGVQENVEFKINISFDELKNYLSEATIGL
H
TMWNEHFGI
GVVECMAAGTVILAHNSGGPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQ
I
RKNARASISRFSDQEFEVAFLCSMEKLLT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser