NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS41787.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41787.2 Public Homo sapiens 12 KRT4 22 109 92 CCDS HistoryNCBI Gene:3851Re-query CCDS DB by CCDS ID:41787.2Re-query CCDS DB by GeneID:3851See the combined annotation on chromosome 12 in Sequence Viewer

Public Note for CCDS 41787.1
The coding region has been updated to shorten the N-terminus to one that is more supported by the available transcript and conservation data.

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 41787.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000551956.1 ENSP00000448220.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000551956.1Link to Ensembl Protein Viewer:ENSP00000448220.1Re-query CCDS DB by Nucleotide ID:ENST00000551956Re-query CCDS DB by Protein ID:ENSP00000448220
Original member NCBI NM_002272.3 NP_002263.3 Updated not alive Link to Nucleotide Sequence:NM_002272.3Link to Protein Sequence:NP_002263.3Re-query CCDS DB by Nucleotide ID:NM_002272Re-query CCDS DB by Protein ID:NP_002263
Current member NCBI NM_002272.4 NP_002263.3 Accepted alive Link to Nucleotide Sequence:NM_002272.4Link to Protein Sequence:NP_002263.3Re-query CCDS DB by Nucleotide ID:NM_002272Re-query CCDS DB by Protein ID:NP_002263Link to BLAST:NP_002263.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002263.3 520 P19013 520 100% 0 0

Chromosomal Locations for CCDS 41787.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52807069 52807250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52807359 52807393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52807644 52807864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52808294 52808419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52808686 52808850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52809383 52809478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52810756 52810816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52811763 52811977 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52813597 52814058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGATTGCCAGACAGCAGTGTGTCCGAGGCGGGCCCCGGGGCTTCAGCTGTGGCTCGGCCATTGTAGGCG
GT
GGCAAGAGAGGTGCCTTCAGCTCAGTCTCCATGTCTGGAGGTGCTGGCCGATGCTCTTCTGGGGGATT
T
GGCAGCAGAAGCCTCTACAACCTCAGGGGGAACAAAAGCATCTCCATGAGTGTGGCTGGGTCACGACAA
GGT
GCCTGCTTTGGGGGTGCTGGAGGCTTTGGCACTGGTGGCTTTGGTGGTGGATTTGGGGGCTCCTTCA
GT
GGTAAGGGTGGCCCTGGCTTCCCCGTCTGCCCCGCTGGGGGAATTCAGGAGGTCACCATCAACCAGAG
C
TTGCTCACCCCCCTCCACGTGGAGATTGACCCTGAGATCCAGAAAGTCCGGACGGAAGAGCGCGAACAG
ATC
AAGCTCCTCAACAACAAGTTTGCCTCCTTCATCGACAAGGTGCAGTTCTTAGAGCAACAGAATAAGG
TC
CTGGAGACCAAATGGAACCTGCTCCAGCAGCAGACGACCACCACCTCCAGCAAAAACCTTGAGCCCCT
C
TTTGAGACCTACCTCAGTGTCCTGAGGAAGCAGCTAGATACCTTGGGCAATGACAAAGGGCGCCTGCAG
TCT
GAGCTGAAGACCATGCAGGACAGCGTGGAGGACTTCAAGACTAAGTATGAAGAGGAGATCAACAAAC
GC
ACAGCAGCCGAGAATGACTTTGTGGTCCTAAAGAAGGACGTGGATGCTGCCTACCTGAACAAGGTGGA
G
TTGGAGGCCAAGGTGGACAGTCTTAATGACGAGATCAACTTCCTGAAGGTCCTCTATGATGCGGAGCTG
TCC
CAGATGCAGACCCATGTCAGCGACACGTCCGTGGTCCTTTCCATGGACAACAACCGCAACCTGGACC
TG
GACAGCATTATTGCCGAGGTCCGTGCCCAGTACGAGGAGATTGCCCAGAGGAGCAAGGCTGAGGCTGA
A
GCCCTGTACCAGACCAAGGTCCAGCAGCTCCAGATCTCGGTTGACCAACATGGTGACAACCTGAAGAAC
ACC
AAGAGTGAAATTGCAGAGCTCAACAGGATGATCCAGAGGCTGCGGGCAGAGATCGAGAACATCAAGA
AG
CAGTGCCAGACTCTTCAGGTATCCGTGGCTGATGCAGAGCAGCGAGGTGAGAATGCCCTTAAAGATGC
C
CACAGCAAGCGCGTAGAGCTGGAGGCTGCCCTGCAGCAGGCCAAGGAGGAGCTGGCACGAATGCTGCGT
GAG
TACCAGGAGCTCATGAGTGTGAAGCTGGCCTTGGACATCGAGATCGCCACCTACCGCAAACTGCTGG
AG
GGCGAGGAGTACAGAATGTCTGGAGAATGCCAGAGTGCCGTGAGCATCTCTGTGGTCAGCGGTAGCAC
C
AGCACTGGAGGCATCAGCGGAGGATTAGGAAGTGGCTCCGGGTTTGGCCTGAGTAGTGGCTTTGGCTCC
GGC
TCTGGAAGTGGCTTTGGGTTTGGTGGCAGTGTCTCTGGCAGTTCCAGCAGCAAGATCATCTCTACCA
CC
ACCCTGAACAAGAGACGATAG


Translation (520 aa):
MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQ
G
ACFGGAGGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQ
I
KLLNNKFASFIDK
VQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQ
S
ELKTMQDSVEDFKT
KYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAEL
S
QMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTK
VQQLQISVDQHGDNLKN
T
KSEIAELNRMIQRLRAEIENIKKQ
CQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLR
E
YQELMSVKLALDIEIATYRKLLEGEEY
RMSGECQSAVSISVVSGSTSTGGISGGLGSGSGFGLSSGFGS
G
SGSGFGFGGSVSGSSSSKIISTTTLNKRR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser