NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS42317.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42317.1 Public Homo sapiens 17 RARA 22 109 92 CCDS HistoryNCBI Gene:5914Re-query CCDS DB by CCDS ID:42317.1Re-query CCDS DB by GeneID:5914See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42317.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000394081.7 ENSP00000377643.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394081.7Link to Ensembl Protein Viewer:ENSP00000377643.3Re-query CCDS DB by Nucleotide ID:ENST00000394081Re-query CCDS DB by Protein ID:ENSP00000377643
Original member NCBI NM_001024809.3 NP_001019980.1 Updated not alive Link to Nucleotide Sequence:NM_001024809.3Link to Protein Sequence:NP_001019980.1Re-query CCDS DB by Nucleotide ID:NM_001024809Re-query CCDS DB by Protein ID:NP_001019980
Current member NCBI NM_001024809.4 NP_001019980.1 Accepted alive Link to Nucleotide Sequence:NM_001024809.4Link to Protein Sequence:NP_001019980.1Re-query CCDS DB by Nucleotide ID:NM_001024809Re-query CCDS DB by Protein ID:NP_001019980Link to BLAST:NP_001019980.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001019980.1 457 P10276-2 457 100% 0 0

Chromosomal Locations for CCDS 42317.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 40342705 40342867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40348316 40348464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40349784 40349925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40351910 40352070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40352331 40352507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40354302 40354506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40355263 40355421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 40356009 40356226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1374 nt):
ATGTACGAGAGTGTAGAAGTGGGGGGTCCCACCCCTAATCCCTTCCTAGTGGTGGATTTTTATAACCAGA
AC
CGGGCCTGTTTGCTCCCAGAGAAGGGGCTCCCCGCCCCGGGTCCGTACTCCACCCCGCTCCGGACTCC
G
CTTTGGAATGGCTCAAACCACTCCATTGAGACCCAGAGCAGCAGTTCTGAAGAGATAGTGCCCAGCCCT
CCC
TCGCCACCCCCTCTACCCCGCATCTACAAGCCTTGCTTTGTCTGTCAGGACAAGTCCTCAGGCTACC
AC
TATGGGGTCAGCGCCTGTGAGGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATGGTGTA
C
ACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGCCGACTG
CAG
AAGTGCTTTGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAACGACCGAAACAAGAAGAAGAAGGAGG
TG
CCCAAGCCCGAGTGCTCTGAGAGCTACACGCTGACGCCGGAGGTGGGGGAGCTCATTGAGAAGGTGCG
C
AAAGCGCACCAGGAAACCTTCCCTGCCCTCTGCCAGCTGGGCAAATACACTACGAACAACAGCTCAGAA
CAA
CGTGTCTCTCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGA
CT
GTGGAGTTCGCCAAGCAGCTGCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCTCCTCAA
G
GCTGCCTGCCTGGACATCCTGATCCTGCGGATCTGCACGCGGTACACGCCCGAGCAGGACACCATGACC
TTC
TCGGACGGGCTGACCCTGAACCGGACCCAGATGCACAACGCTGGCTTCGGCCCCCTCACCGACCTGG
TC
TTTGCCTTCGCCAACCAGCTGCTGCCCCTGGAGATGGATGATGCGGAGACGGGGCTGCTCAGCGCCAT
C
TGCCTCATCTGCGGAGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTG
CTG
GAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAA
TG
AAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
C
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGA
CAG
CCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCA
GC
CCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGA


Translation (457 aa):
MYESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSP
P
SPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCK
GFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRL
Q
KCFEVGMSKE
SVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSE
Q
RVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDIL
ILRICTRYTPEQDTMT
F
SDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICG
DRQDLEQPDRVDMLQEPL
L
EALKVYVRKRRPSRPHMFPKMLMKITDLRSISAK
GAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSG
Q
PGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser