NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43851.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43851.1 Public Homo sapiens 9 PTCH1 22 109 92 CCDS HistoryNCBI Gene:5727Re-query CCDS DB by CCDS ID:43851.1Re-query CCDS DB by GeneID:5727See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43851.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000418258.5 ENSP00000396135.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000418258.5Link to Ensembl Protein Viewer:ENSP00000396135.1Re-query CCDS DB by Nucleotide ID:ENST00000418258Re-query CCDS DB by Protein ID:ENSP00000396135
Original member Current member EBI ENST00000421141.5 ENSP00000399981.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000421141.5Link to Ensembl Protein Viewer:ENSP00000399981.1Re-query CCDS DB by Nucleotide ID:ENST00000421141Re-query CCDS DB by Protein ID:ENSP00000399981
Original member Current member EBI ENST00000429896.6 ENSP00000414823.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000429896.6Link to Ensembl Protein Viewer:ENSP00000414823.2Re-query CCDS DB by Nucleotide ID:ENST00000429896Re-query CCDS DB by Protein ID:ENSP00000414823
Original member NCBI NM_001083604.2 NP_001077073.1 Updated not alive Link to Nucleotide Sequence:NM_001083604.2Link to Protein Sequence:NP_001077073.1Re-query CCDS DB by Nucleotide ID:NM_001083604Re-query CCDS DB by Protein ID:NP_001077073
Current member NCBI NM_001083604.3 NP_001077073.1 Accepted alive Link to Nucleotide Sequence:NM_001083604.3Link to Protein Sequence:NP_001077073.1Re-query CCDS DB by Nucleotide ID:NM_001083604Re-query CCDS DB by Protein ID:NP_001077073Link to BLAST:NP_001077073.1
Original member NCBI NM_001083605.2 NP_001077074.1 Updated not alive Link to Nucleotide Sequence:NM_001083605.2Link to Protein Sequence:NP_001077074.1Re-query CCDS DB by Nucleotide ID:NM_001083605Re-query CCDS DB by Protein ID:NP_001077074
Current member NCBI NM_001083605.3 NP_001077074.1 Accepted alive Link to Nucleotide Sequence:NM_001083605.3Link to Protein Sequence:NP_001077074.1Re-query CCDS DB by Nucleotide ID:NM_001083605Re-query CCDS DB by Protein ID:NP_001077074Link to BLAST:NP_001077074.1
Original member NCBI NM_001083606.2 NP_001077075.1 Updated not alive Link to Nucleotide Sequence:NM_001083606.2Link to Protein Sequence:NP_001077075.1Re-query CCDS DB by Nucleotide ID:NM_001083606Re-query CCDS DB by Protein ID:NP_001077075
Current member NCBI NM_001083606.3 NP_001077075.1 Accepted alive Link to Nucleotide Sequence:NM_001083606.3Link to Protein Sequence:NP_001077075.1Re-query CCDS DB by Nucleotide ID:NM_001083606Re-query CCDS DB by Protein ID:NP_001077075Link to BLAST:NP_001077075.1
Original member NCBI NM_001083607.2 NP_001077076.1 Updated not alive Link to Nucleotide Sequence:NM_001083607.2Link to Protein Sequence:NP_001077076.1Re-query CCDS DB by Nucleotide ID:NM_001083607Re-query CCDS DB by Protein ID:NP_001077076
Current member NCBI NM_001083607.3 NP_001077076.1 Accepted alive Link to Nucleotide Sequence:NM_001083607.3Link to Protein Sequence:NP_001077076.1Re-query CCDS DB by Nucleotide ID:NM_001083607Re-query CCDS DB by Protein ID:NP_001077076Link to BLAST:NP_001077076.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001077073.1 1296 Q13635-4 1296 100% 0 0
NP_001077074.1 1296 Q13635-4 1296 100% 0 0
NP_001077075.1 1296 Q13635-4 1296 100% 0 0
NP_001077076.1 1296 Q13635-4 1296 100% 0 0

Chromosomal Locations for CCDS 43851.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 95446912 95447451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95449069 95449323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95449841 95449940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95453478 95453620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95456276 95456413 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95458013 95458293 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95459600 95459783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95461856 95461998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95467116 95467425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95468751 95469153 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95469813 95469931 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95476034 95476159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95476759 95476857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95477547 95477702 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95478055 95478186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95479000 95479147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95479969 95480090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95480390 95480588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95481949 95482040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95482134 95482203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 95485685 95485815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3891 nt):
ATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGC
TC
CTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAA
A
TTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAA
TAT
CTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGA
CA
GCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTT
A
AAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTAC
ATG
GACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCA
AA
CCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCA
G
GAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAG
ACC
ATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACA
TC
AACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCA
T
CAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTG
AAA
TCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTC
TA
ACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGC
A
CTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAG
GTT
TTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAA
CA
GGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGT
G
GCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGG
GCG
TTCTCCCTCCAGGCAGCGGTAGTAGTGGTGTTCAATTTTGCCATGGTTCTGCTCATTTTTCCTGCAA
TT
CTCAGCATGGATTTATATCGACGCGAGGACAGGAGACTGGATATTTTCTGCTGTTTTACAAGCCCCTG
C
GTCAGCAGAGTGATTCAGGTTGAACCTCAGGCCTACACCGACACACACGACAATACCCGCTACAGCCCC
CCA
CCTCCCTACAGCAGCCACAGCTTTGCCCATGAAACGCAGATTACCATGCAGTCCACTGTCCAGCTCC
GC
ACGGAGTACGACCCCCACACGCACGTGTACTACACCACCGCTGAGCCGCGCTCCGAGATCTCTGTGCA
G
CCCGTCACCGTGACACAGGACACCCTCAGCTGCCAGAGCCCAGAGAGCACCAGCTCCACAAGGGACCTG
CTC
TCCCAGTTCTCCGACTCCAGCCTCCACTGCCTCGAGCCCCCCTGTACGAAGTGGACACTCTCATCTT
TT
GCTGAGAAGCACTATGCTCCTTTCCTCTTGAAACCAAAAGCCAAGGTAGTGGTGATCTTCCTTTTTCT
G
GGCTTGCTGGGGGTCAGCCTTTATGGCACCACCCGAGTGAGAGACGGGCTGGACCTTACGGACATTGTA
CCT
CGGGAAACCAGAGAATATGACTTTATTGCTGCACAATTCAAATACTTTTCTTTCTACAACATGTATA
TA
GTCACCCAGAAAGCAGACTACCCGAATATCCAGCACTTACTTTACGACCTACACAGGAGTTTCAGTAA
C
GTGAAGTATGTCATGTTGGAAGAAAACAAACAGCTTCCCAAAATGTGGCTGCACTACTTCAGAGACTGG
CTT
CAGGGACTTCAGGATGCATTTGACAGTGACTGGGAAACCGGGAAAATCATGCCAAACAATTACAAGA
AT
GGATCAGACGATGGAGTCCTTGCCTACAAACTCCTGGTGCAAACCGGCAGCCGCGATAAGCCCATCGA
C
ATCAGCCAGTTGACTAAACAGCGTCTGGTGGATGCAGATGGCATCATTAATCCCAGCGCTTTCTACATC
TAC
CTGACGGCTTGGGTCAGCAACGACCCCGTCGCGTATGCTGCCTCCCAGGCCAACATCCGGCCACACC
GA
CCAGAATGGGTCCACGACAAAGCCGACTACATGCCTGAAACAAGGCTGAGAATCCCGGCAGCAGAGCC
C
ATCGAGTATGCCCAGTTCCCTTTCTACCTCAACGGCTTGCGGGACACCTCAGACTTTGTGGAGGCAATT
GAA
AAAGTAAGGACCATCTGCAGCAACTATACGAGCCTGGGGCTGTCCAGTTACCCCAACGGCTACCCCT
TC
CTCTTCTGGGAGCAGTACATCGGCCTCCGCCACTGGCTGCTGCTGTTCATCAGCGTGGTGTTGGCCTG
C
ACATTCCTCGTGTGCGCTGTCTTCCTTCTGAACCCCTGGACGGCCGGGATCATTGTGATGGTCCTGGCG
CTG
ATGACGGTCGAGCTGTTCGGCATGATGGGCCTCATCGGAATCAAGCTCAGTGCCGTGCCCGTGGTCA
TC
CTGATCGCTTCTGTTGGCATAGGAGTGGAGTTCACCGTTCACGTTGCTTTGGCCTTTCTGACGGCCAT
C
GGCGACAAGAACCGCAGGGCTGTGCTTGCCCTGGAGCACATGTTTGCACCCGTCCTGGATGGCGCCGTG
TCC
ACTCTGCTGGGAGTGCTGATGCTGGCGGGATCTGAGTTCGACTTCATTGTCAGGTATTTCTTTGCTG
TG
CTGGCGATCCTCACCATCCTCGGCGTTCTCAATGGGCTGGTTTTGCTTCCCGTGCTTTTGTCTTTCTT
T
GGACCATATCCTGAGGTGTCTCCAGCCAACGGCTTGAACCGCCTGCCCACACCCTCCCCTGAGCCACCC
CCC
AGCGTGGTCCGCTTCGCCATGCCGCCCGGCCACACGCACAGCGGGTCTGATTCCTCCGACTCGGAGT
AT
AGTTCCCAGACGACAGTGTCAGGCCTCAGCGAGGAGCTTCGGCACTACGAGGCCCAGCAGGGCGCGGG
A
GGCCCTGCCCACCAAGTGATCGTGGAAGCCACAGAAAACCCCGTCTTCGCCCACTCCACTGTGGTCCAT
CCC
GAATCCAGGCATCACCCACCCTCGAACCCGAGACAGCAGCCCCACCTGGACTCAGGGTCCCTGCCTC
CC
GGACGGCAAGGCCAGCAGCCCCGCAGGGACCCCCCCAGAGAAGGCTTGTGGCCACCCCCCTACAGACC
G
CGCAGAGACGCTTTTGAAATTTCTACTGAAGGGCATTCTGGCCCTAGCAATAGGGCCCGCTGGGGCCCT
CGC
GGGGCCCGTTCTCACAACCCTCGGAACCCAGCGTCCACTGCCATGGGCAGCTCCGTGCCCGGCTACT
GC
CAGCCCATCACCACTGTGACGGCTTCTGCCTCCGTGACTGTCGCCGTGCACCCGCCGCCTGTCCCTGG
G
CCTGGGCGGAACCCCCGAGGGGGACTCTGCCCAGGCTACCCTGAGACTGACCACGGCCTGTTTGAGGAC
CCC
CACGTGCCTTTCCACGTCCGGTGTGAGAGGAGGGATTCGAAGGTGGAAGTCATTGAGCTGCAGGACG
TG
GAATGCGAGGAGAGGCCCCGGGGAAGCAGCTCCAACTGA


Translation (1296 aa):
MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIE
Y
LYPCLIITPLDCFWEGAKLQSGTAYL
LGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGY
M
DRPCLNPADPDCPATAPNKNSTK
PLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQ
T
MFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVE
VVHQSVAQNSTQKVLSFTTTTLDDIL
K
SFSDVSVIRVASGYLLM
LAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQ
V
LPFLALGVGVDDVFLLAHAFSETGQNKRIPFE
DRTGECLKRTGASVALTSISNVTAFFMAALIPIPALR
A
FSLQ
AAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSP
P
PPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDL
L
SQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAK
VVVIFLFLGLLGVSLYGTTRVRDGLDLTDIV
P
RETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDW
L
Q
GLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYI
Y
LTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLR
IPAAEPIEYAQFPFYLNGLRDTSDFVEAI
E
KVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGII
VMVLA
L
MTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVAL
AFLTAIGDKNRRAVLALEHMFAPVLDGAV
S
TLLGVLMLAGSEFDFIV
RYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPP
P
SVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHST
VVH
P
ESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGP
R
GARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFED
P
HVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser