NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS44370.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44370.1 Public Homo sapiens 10 ZEB1 22 109 92 CCDS HistoryNCBI Gene:6935Re-query CCDS DB by CCDS ID:44370.1Re-query CCDS DB by GeneID:6935See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 44370.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000446923.6 ENSP00000391612.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000446923.6Link to Ensembl Protein Viewer:ENSP00000391612.2Re-query CCDS DB by Nucleotide ID:ENST00000446923Re-query CCDS DB by Protein ID:ENSP00000391612
Original member NCBI NM_001128128.2 NP_001121600.1 Updated not alive Link to Nucleotide Sequence:NM_001128128.2Link to Protein Sequence:NP_001121600.1Re-query CCDS DB by Nucleotide ID:NM_001128128Re-query CCDS DB by Protein ID:NP_001121600
Current member NCBI NM_001128128.3 NP_001121600.1 Accepted alive Link to Nucleotide Sequence:NM_001128128.3Link to Protein Sequence:NP_001121600.1Re-query CCDS DB by Nucleotide ID:NM_001128128Re-query CCDS DB by Protein ID:NP_001121600Link to BLAST:NP_001121600.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001121600.1 1108 P37275-5 1108 100% 0 0

Chromosomal Locations for CCDS 44370.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 31321526 31321532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31461037 31461237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31495776 31495838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31502348 31502509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31510673 31510875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31514603 31514708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31520126 31521936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31523933 31524113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 31526672 31527264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3327 nt):
ATGAAAGTTACAAATTATAATACTGTGGTAGAAACAAATTCAGATTCAGATGATGAAGACAAACTGCATA
TT
GTGGAAGAAGAAAGTGTTACAGATGCAGCTGACTGTGAAGGTGTACCAGAGGATGACCTGCCAACAGA
C
CAGACAGTGTTACCAGGGAGGAGCAGTGAAAGAGAAGGGAATGCTAAGAACTGCTGGGAGGATGACACA
GGA
AAGGAAGGGCAAGAAATCCTGGGGCCTGAAGCTCAGGCAGATGAAGCAGGATGTACAGTAAAAGATG
AT
GAATGCGAGTCAGATGCAGAAAATGAGCAAAACCATGATCCTAATGTTGAAGAGTTTCTACAACAACA
A
GACACTGCTGTCATTTTTCCTGAGGCACCTGAAGAGGACCAGAGGCAGGGCACACCAGAAGCCAGTGGT
CAT
GATGAAAATGGAACACCAGATGCATTTTCACAATTACTCACCTGTCCATATTGTGATAGAGGCTATA
AA
CGCTTTACCTCTCTGAAAGAACACATTAAATATCGTCATGAAAAGAATGAAGATAACTTTAGTTGCTC
C
CTGTGCAGTTACACCTTTGCATACAGAACCCAACTTGAACGTCACATGACATCACATAAATCAGGAAGA
GAT
CAAAGACATGTGACGCAGTCTGGGTGTAATCGTAAATTCAAATGCACTGAGTGTGGAAAAGCTTTCA
AA
TACAAACATCACCTAAAAGAGCACTTAAGAATTCACAGTGGAGAGAAGCCATATGAATGCCCAAACTG
C
AAGAAACGCTTTTCCCATTCTGGCTCCTATAGCTCACACATAAGCAGTAAGAAATGTATCAGCTTGATA
CCT
GTGAATGGGCGACCAAGAACAGGACTCAAGACATCTCAGTGTTCTTCACCGTCTCTTTCAGCATCAC
CA
GGCAGTCCCACACGACCACAGATACGGCAAAAGATAGAGAATAAACCCCTTCAAGAACAACTTTCTGT
T
AACCAAATTAAAACTGAACCTGTGGATTATGAATTCAAACCCATAGTGGTTGCTTCAGGAATCAACTGT
TCA
ACCCCTTTACAAAATGGGGTTTTCACTGGTGGTGGCCCATTACAGGCAACCAGTTCTCCTCAGGGCA
TG
GTGCAAGCTGTTGTTCTGCCAACAGTTGGTTTGGTGTCTCCCATAAGTATCAATTTAAGTGATATTCA
G
AATGTACTTAAAGTGGCGGTAGATGGTAATGTAATAAGGCAAGTGTTGGAGAATAATCAAGCCAATCTT
GCA
TCCAAAGAACAAGAAACAATCAATGCTTCACCCATACAACAAGGTGGCCATTCTGTTATTTCAGCCA
TC
AGTCTTCCTTTGGTTGATCAAGATGGAACAACCAAAATTATCATCAACTACAGTCTTGAGCAGCCTAG
C
CAACTTCAAGTTGTTCCTCAAAATTTAAAAAAAGAAAATCCAGTCGCTACAAACAGTTGTAAAAGTGAA
AAG
TTACCAGAAGATCTTACTGTTAAGTCTGAGAAGGACAAAAGCTTTGAAGGGGGGGTGAATGATAGCA
CT
TGTCTTCTGTGTGATGATTGTCCAGGAGATATTAATGCACTTCCAGAATTAAAGCACTATGACCTAAA
G
CAGCCTACTCAGCCTCCTCCACTCCCTGCAGCAGAAGCTGAGAAGCCTGAGTCCTCTGTTTCATCAGCT
ACT
GGAGATGGCAATTTGTCTCCTAGTCAGCCACCTTTAAAGAACCTCTTGTCTCTCCTAAAAGCATATT
AT
GCTTTGAATGCACAACCAAGTGCAGAAGAGCTCTCAAAAATTGCTGATTCAGTAAACCTACCACTGGA
T
GTAGTAAAAAAGTGGTTTGAAAAGATGCAAGCTGGACAGATTTCAGTGCAGTCTTCTGAACCATCTTCT
CCT
GAACCAGGCAAAGTAAATATCCCTGCCAAGAACAATGATCAGCCTCAATCTGCAAATGCAAATGAAC
CC
CAGGACAGCACAGTAAATCTACAAAGTCCTTTGAAGATGACTAACTCCCCAGTTTTACCAGTGGGATC
A
ACCACCAATGGTTCCAGAAGTAGTACACCATCCCCATCACCTCTAAACCTTTCCTCATCCAGAAATACA
CAG
GGTTACTTGTACACAGCTGAGGGTGCACAAGAAGAGCCACAAGTAGAACCTCTTGATCTTTCACTAC
CA
AAGCAACAGGGAGAATTATTAGAAAGGTCAACTATCACTAGTGTTTACCAGAACAGTGTTTATTCTGT
C
CAGGAAGAACCCTTGAACTTGTCTTGCGCAAAAAAGGAGCCACAAAAGGACAGTTGTGTTACAGACTCA
GAA
CCAGTTGTAAATGTAATCCCACCAAGTGCCAACCCCATAAATATCGCTATACCTACAGTCACTGCCC
AG
TTACCCACAATCGTGGCCATTGCTGACCAGAACAGTGTTCCATGCTTAAGAGCGCTAGCTGCCAATAA
G
CAAACGATTCTGATTCCCCAGGTGGCATACACCTACTCAACTACGGTCAGCCCTGCAGTCCAAGAACCA
CCC
TTGAAAGTGATCCAGCCAAATGGAAATCAGGATGAAAGACAAGATACTAGCTCAGAAGGAGTATCAA
AT
GTAGAGGATCAGAATGACTCTGATTCTACACCGCCCAAAAAGAAAATGCGGAAGACAGAAAATGGAAT
G
TATGCTTGTGATTTGTGTGACAAGATATTCCAAAAGAGTAGTTCATTATTGAGACATAAATATGAACAC
ACA
GGTAAAAGACCTCATGAGTGTGGAATCTGTAAAAAGGCATTTAAACACAAACATCATTTGATTGAAC
AC
ATGCGATTACATTCTGGAGAAAAGCCCTATCAATGTGACAAATGTGGAAAGCGCTTCTCACACTCTGG
G
TCTTATTCTCAACACATGAATCATCGCTACTCCTACTGTAAGAGAGAAGCGGAAGAACGTGACAGCACA
GAG
CAGGAAGAGGCAGGGCCTGAAATCCTCTCGAATGAGCACGTGGGTGCCAGGGCGTCTCCCTCACAGG
GC
GACTCGGACGAGAGAGAGAGTTTGACAAGGGAAGAGGATGAAGACAGTGAAAAAGAGGAAGAGGAGGA
G
GATAAAGAGATGGAAGAATTGCAGGAAGAAAAAGAATGTGAAAAACCACAAGGGGATGAGGAAGAGGAG
GAG
GAGGAGGAAGAAGTGGAAGAAGAAGAGGTAGAAGAGGCAGAGAATGAGGGAGAAGAAGCAAAAACTG
AA
GGTCTGATGAAGGATGACAGGGCTGAAAGTCAAGCAAGCAGCTTAGGACAAAAAGTAGGCGAGAGTAG
T
GAGCAAGTGTCTGAAGAAAAGACAAATGAAGCCTAA


Translation (1108 aa):
MKVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDT
G
KEGQEILGPEAQADEAGCT
VKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASG
H
DEN
GTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGR
D
Q
RHVTQSGCNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLI
P
VNGRPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVVASGINC
S
TPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANL
A
SKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSE
K
LPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSA
T
GDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSS
P
EPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNT
Q
GYLYTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDS
E
PVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEP
P
LKVIQPNGNQ
DERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEH
T
GKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDST
E
QEEAGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEE
E
EEEEVEEEEVEEAENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser