NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46934.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46934.1 Public Homo sapiens 3 PFN2 22 109 92 CCDS HistoryNCBI Gene:5217Re-query CCDS DB by CCDS ID:46934.1Re-query CCDS DB by GeneID:5217See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46934.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000452853.6 ENSP00000410464.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000452853.6Link to Ensembl Protein Viewer:ENSP00000410464.2Re-query CCDS DB by Nucleotide ID:ENST00000452853Re-query CCDS DB by Protein ID:ENSP00000410464
Original member NCBI NM_002628.4 NP_002619.1 Updated not alive Link to Nucleotide Sequence:NM_002628.4Link to Protein Sequence:NP_002619.1Re-query CCDS DB by Nucleotide ID:NM_002628Re-query CCDS DB by Protein ID:NP_002619
Current member NCBI NM_002628.5 NP_002619.1 Accepted alive Link to Nucleotide Sequence:NM_002628.5Link to Protein Sequence:NP_002619.1Re-query CCDS DB by Nucleotide ID:NM_002628Re-query CCDS DB by Protein ID:NP_002619Link to BLAST:NP_002619.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002619.1 140 P35080-2 140 100% 0 0

Chromosomal Locations for CCDS 46934.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 149966167 149966264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 149968358 149968550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 149970725 149970856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (423 nt):
ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCCGCCATTGTCG
GC
TACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTTCAGAGCATTACGCCAATAGA
A
ATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTTACCAACGGTTTGACTCTTGGCGCGAAGAAA
TGC
TCAGTGATCAGAGATAGTCTATACGTCGATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAG
GT
GGGGAGCCAACATACAATGTGGCTGTCGGCAGAGCTGGTAGAGCATTGGTTATAGTCATGGGAAAGGA
A
GGTGTCCACGGAGGCACACTTAACAAGAAAGCATATGAACTCGCTTTATACCTGAGGAGGTCTGATGTG
TAA


Translation (140 aa):
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK
C
SVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGR
ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser