NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS47832.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47832.1 Public Homo sapiens 8 CLU 22 109 92 CCDS HistoryNCBI Gene:1191Re-query CCDS DB by CCDS ID:47832.1Re-query CCDS DB by GeneID:1191See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47832.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000316403.14 ENSP00000315130.10 Accepted alive Link to Ensembl Transcript Viewer:ENST00000316403.14Link to Ensembl Protein Viewer:ENSP00000315130.10Re-query CCDS DB by Nucleotide ID:ENST00000316403Re-query CCDS DB by Protein ID:ENSP00000315130
Original member Current member EBI ENST00000405140.7 ENSP00000385419.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000405140.7Link to Ensembl Protein Viewer:ENSP00000385419.3Re-query CCDS DB by Nucleotide ID:ENST00000405140Re-query CCDS DB by Protein ID:ENSP00000385419
Original member Current member EBI ENST00000523500.5 ENSP00000429620.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000523500.5Link to Ensembl Protein Viewer:ENSP00000429620.1Re-query CCDS DB by Nucleotide ID:ENST00000523500Re-query CCDS DB by Protein ID:ENSP00000429620
Original member NCBI NM_001831.3 NP_001822.3 Updated not alive Link to Nucleotide Sequence:NM_001831.3Link to Protein Sequence:NP_001822.3Re-query CCDS DB by Nucleotide ID:NM_001831Re-query CCDS DB by Protein ID:NP_001822
Current member NCBI NM_001831.4 NP_001822.3 Accepted alive Link to Nucleotide Sequence:NM_001831.4Link to Protein Sequence:NP_001822.3Re-query CCDS DB by Nucleotide ID:NM_001831Re-query CCDS DB by Protein ID:NP_001822Link to BLAST:NP_001822.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001822.3 449 P10909-1 449 100% 0 0

Chromosomal Locations for CCDS 47832.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 27598241 27598250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27598460 27598635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27599780 27600009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27604291 27604395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27604924 27605335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27606354 27606524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27608938 27609086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 27610475 27610571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1350 nt):
ATGATGAAGACTCTGCTGCTGTTTGTGGGGCTGCTGCTGACCTGGGAGAGTGGGCAGGTCCTGGGGGACC
AG
ACGGTCTCAGACAATGAGCTCCAGGAAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCA
A
AATGCTGTCAACGGGGTGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTG
CTC
AGCAACCTAGAAGAAGCCAAGAAGAAGAAAGAGGATGCCCTAAATGAGACCAGGGAATCAGAGACAA
AG
CTGAAGGAGCTCCCAGGAGTGTGCAATGAGACCATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCT
G
AAACAGACCTGCATGAAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAGCTT
GAG
GAGTTCCTGAACCAGAGCTCGCCCTTCTACTTCTGGATGAATGGTGACCGCATCGACTCCCTGCTGG
AG
AACGACCGGCAGCAGACGCACATGCTGGATGTCATGCAGGACCACTTCAGCCGCGCGTCCAGCATCAT
A
GACGAGCTCTTCCAGGACAGGTTCTTCACCCGGGAGCCCCAGGATACCTACCACTACCTGCCCTTCAGC
CTG
CCCCACCGGAGGCCTCACTTCTTCTTTCCCAAGTCCCGCATCGTCCGCAGCTTGATGCCCTTCTCTC
CG
TACGAGCCCCTGAACTTCCACGCCATGTTCCAGCCCTTCCTTGAGATGATACACGAGGCTCAGCAGGC
C
ATGGACATCCACTTCCATAGCCCGGCCTTCCAGCACCCGCCAACAGAATTCATACGAGAAGGCGACGAT
GAC
CGGACTGTGTGCCGGGAGATCCGCCACAACTCCACGGGCTGCCTGCGGATGAAGGACCAGTGTGACA
AG
TGCCGGGAGATCTTGTCTGTGGACTGTTCCACCAACAACCCCTCCCAGGCTAAGCTGCGGCGGGAGCT
C
GACGAATCCCTCCAGGTCGCTGAGAGGTTGACCAGGAAATACAACGAGCTGCTAAAGTCCTACCAGTGG
AAG
ATGCTCAACACCTCCTCCTTGCTGGAGCAGCTGAACGAGCAGTTTAACTGGGTGTCCCGGCTGGCAA
AC
CTCACGCAAGGCGAAGACCAGTACTATCTGCGGGTCACCACGGTGGCTTCCCACACTTCTGACTCGGA
C
GTTCCTTCCGGTGTCACTGAGGTGGTCGTGAAGCTCTTTGACTCTGATCCCATCACTGTGACGGTCCCT
GTA
GAAGTCTCCAGGAAGAACCCTAAATTTATGGAGACCGTGGCGGAGAAAGCGCTGCAGGAATACCGCA
AA
AAGCACCGGGAGGAGTGA


Translation (449 aa):
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTL
L
SNLEEAKKKKE
DALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQL
E
EFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFS
L
PHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIR
EGDD
D
RTVCREIRHNSTGCLRMKDQCDKCREILSV
DCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQW
K
MLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTT
VASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
V
EVSRKNPKFMETVAEKALQEYRKKH
REE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser