NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48424.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48424.1 Public Mus musculus 1 Dcaf6 23 108 98 CCDS HistoryNCBI Gene:74106Re-query CCDS DB by CCDS ID:48424.1Re-query CCDS DB by GeneID:74106See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48424.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000027856.12 ENSMUSP00000027856.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027856.12Link to Ensembl Protein Viewer:ENSMUSP00000027856.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000027856Re-query CCDS DB by Protein ID:ENSMUSP00000027856
Original member Current member NCBI NM_028759.1 NP_083035.1 Accepted alive Link to Nucleotide Sequence:NM_028759.1Link to Protein Sequence:NP_083035.1Re-query CCDS DB by Nucleotide ID:NM_028759Re-query CCDS DB by Protein ID:NP_083035Link to BLAST:NP_083035.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083035.1 876 Q9DC22 876 100% 0 0

Chromosomal Locations for CCDS 48424.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 165329939 165330003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165333289 165333394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165336745 165336833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165338188 165338344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165339885 165340023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165350884 165351280 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165351472 165351540 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165351961 165352076 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165357429 165357546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165388658 165388915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165390414 165390533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165392139 165392232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165399654 165399868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165411464 165411599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165420111 165420224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165422856 165423041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165424302 165424394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165429254 165429315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165460131 165460227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2631 nt):
ATGGCTCGGAGTGGCTCCTGCCCGCACCTGTTGTGGGACGTGAGGAAAAGGTCCCTTGGGCTGGAGGACC
CG
TCCCGGCTGAGGAGCCGCTACCTGGGAAGAAGAGAATTTATCCAAAGATTAAAACTTGAAGCAACTTT
A
AATGTGCATGATGGCTGTGTTAATACAATCTGTTGGAATGACACTGGAGAATATATTTTATCTGGCTCT
GAT
GACACTAAACTTGTAATTAGTAATCCATACAGCAGAAAGGTTTTGACAACCATCCGTTCAGGGCATC
GA
GCAAATATATTTAGTGCAAAGTTTTTGCCGTGCACAGATGATAAGCAGATTGTGTCTTGCTCTGGAGA
T
GGAGTCATATTTTATACTAACATTGAGCAAGATGCAGAAACTAACAGACAGTGCCAATTTACGTGCCAT
TAT
GGAACTACTTATGAGATTATGACTGTACCAAACGACCCTTACACCTTTCTGTCCTGTGGTGAAGATG
GA
ACTGTTAGGTGGTTTGACACACGCATCAAAACCAGTTGCACAAAAGAAGACTGTAAAGATGATATTTT
A
ATCAACTGTAGGCGTGCTGCCACATCTGTGGCTATTTGTCCCCCAGTACCATATTACCTTGCTGTGGGT
TGT
TCTGACAGCTCAGTACGGATTTATGATCGGCGAATGCTGGGCACAAGAGCTACAGGGAATTATGCAG
GC
CGAGGAACTACTGGAATGGTTGCTCGATTTATACCTTCTCATCTTAGTAACAAATCATGCAGAGTGAC
A
TCACTGTGTTACAGTGAAGATGGTCAAGAGATTCTTGTCAGTTATTCTTCAGACTACATCTATCTTTTT
GAC
CCCAAAGATGATACTGCACGAGAACTTAAAACTCCTTCTGCAGAGGAGAGGCGAGAAGAGTTACGAC
AG
CCTCCAGTTAAGCGCTTGAGACTTCGTGGTGATTGGTCAGATACTGGTCCCAGAGCACGGCCAGAAAG
T
GAACGAGAACGAGATGGAGAGCAAAGTCCCAATGTGTCACTGATGCAGAGAATGTCTGATATGTTATCA
AGG
TGGTTTGAAGAAGCAAGTGAAGTTGCACAAAGCAACAGAGGAAGAGGAAGACCTCGGCCCAGAGGTG
GA
ACAAATCAGCCAGATGTTTCAACTCTTCCTACGGTTCCATCAAGTCCTAATTTGGAAGTGTGTGAAAC
T
GCAATGGATGTAGACATGCCAGCTGCACTTCTTCAGCCTTCTACATCCTCTACAGATCCAGTTCAGGCT
CAG
GCAGCCACAGCCGCCATAGAAAGCCCTCGTTCCAGCTCGTTGCTGTCTTGCCCAGACAGTGAACCGA
GG
CAGTCTGTTGAGGCGTCTGGACACCATGCACATCATCAGTCAGATAACAGTAATGAGAGGCTGAGCCC
C
AAACCAGGGACAGGTGAACCCGTTTTAAGTTTGCACTACAGCACAGAAGGAACAACTACAAGCACAATA
AAA
CTGAACTTTACAGATGAATGGAGCAGTACAGCCTCAAGTTCCAGAGGAAATGGGAGCCATTGCAAAT
CT
GAGGGTCAGGAAGAATGCTTGGTCCCTCCGAGCTCTGTGCAGCCACCGGAAGGAGACAGTGAAACAAG
A
GCTCCTGAAGAACTATCAGAGAAAGGAACACTTCCAGAAAACCTCACTCAAAACCAGATAGATACAGCA
CAA
CTTGATAACTTCCCAGCTGAGCCATTGGATTCTAACTCAGGAGAGAAGAATAACCCAAGTCAGGACA
GC
CCTTGTGGGCTTCCAGAAGAAGGCACTTTGTCTGAAACAGACAGGGAGACTTGTGAGCAGGCCAGCAC
T
GAGAGTGCTACCAGGCATGCTAGCACCAAGCCTGAACTCCCATCCCAGACAGAAGCCATTGAGCAGGCC
AGC
ACTGAGAGTGCTACCAGGCATACCAGTGCCAATCCTGAACTCCCATCCCAGACAGAAGCCATAGCAC
CT
TTAGCTCATGAAGACCCATCTGCCAGGGACTCTGCTCTCCAGGACACAGATGACAGCGATGATGATCC
G
GTCTTGATCCCTGGTGCAAGATACCGAACAGGACCTGGTGATAGACGCTCCGCTGTTGCCCGCATTCAG
GAG
TTCTTCAGGAGGAGAAAAGAAAGGAAAGAAATGGAAGAGCTGGATACTTTGAACATTAGGAGGCCAC
TA
GTAAAGATGGTTTATAAGGGCCACCGCAACTCCCGGACAATGATAAAAGAAGCCAATTTCTGGGGTGC
T
AACTTTGTAATGAGCGGTTCCGATTGTGGCCATATCTTCATCTGGGACCGGCACACTGCTGAGCATTTG
ATG
CTTCTGGAAGCTGATAATCATGTGGTCAACTGCCTGCAGCCCCATCCGTTTGACCCAATTCTAGCCT
CA
TCTGGCATAGATTATGACATAAAGATCTGGTCGCCACTAGAAGAGTCAAGAATTTTTAATCGAAAACT
T
GCTGATGAAGTTATAACTCGGAATGAACTCATGCTGGAAGAGACTCGGAACACCATCACCGTCCCAGCC
TCT
TTCATGTTGAGGATGTTGGCGTCACTGAATCATATCCGAGCTGACCGTCTGGAGGGTGACAGATCAG
AA
GGTTCAGGTCAGGAGAATGAAAATGAGGATGAAGAATAA


Translation (876 aa):
MARSGSCPHLLWDVRKRSLGLEDPSRLRSRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGS
D
DTKLVISNPYSRK
VLTTIRSGHRANIFSAKFLPCTDDKQIVSCSGDGVIFYTNIEQDAETNRQCQFTCH
Y
GTTYE
IMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPVPYYLAVG
C
SDSSVRIYDRRMLGTRAT
GNYAGRGTTGMVARFIPSHLSNKSCRVTSLCYSEDGQEILVSYSSDYIYLF
D
PKDDTARELKTPSAEERREE
LRQPPVKRLRLRGDWSDTGPRARPESERERDGEQSPNVSLMQRMSDMLS
R
WFEEASEVAQSNRGRGRPRPR
GGTNQPDVSTLPTVPSSPNLEVCETAMDVDMPAALLQPSTSSTDPVQA
Q
AATAAIESPRSSSLLSCPDSEPRQSVEASGHHAHHQS
DNSNERLSPKPGTGEPVLSLHYSTEGTTTSTI
K
LNFTDE
WSSTASSSRGNGSHCKSEGQEECLVPPSSVQPPEGDSETRAPEELSEKGTLPENLTQNQIDTA
Q
LDNFPAEPLDSNSGEKNNPSQDSPCGLPEEGTLSETDRETCEQASTESATRHASTKPELPSQTEAIEQA
S
TESATRHTSANPELPSQTEAIAPLAHEDPSARDSALQDTDDSDDDPVLIPGARYRTGPGD
RRSAVARIQ
E
FFRRRKERKEMEELDTLNIRRPLVKMVYKGHRNSRTM
IKEANFWGANFVMSGSDCGHIFIWDRHTAEHL
M
LLEADNHVVNCLQPHPFDP
ILASSGIDYDIKIWSPLEESRIFNRKLADEVITRNELMLEETRNTITVPA
S
FMLRMLASLNHIRA
DRLEGDRSEGSGQENENEDEE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser