NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS48755.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48755.1 Public Mus musculus 11 Sec61g 23 108 98 CCDS HistoryNCBI Gene:20335Re-query CCDS DB by CCDS ID:48755.1Re-query CCDS DB by GeneID:20335See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48755.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000109641.1 ENSMUSP00000105269.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109641.1Link to Ensembl Protein Viewer:ENSMUSP00000105269.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000109641Re-query CCDS DB by Protein ID:ENSMUSP00000105269
Original member Current member EBI ENSMUST00000109642.7 ENSMUSP00000105270.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109642.7Link to Ensembl Protein Viewer:ENSMUSP00000105270.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000109642Re-query CCDS DB by Protein ID:ENSMUSP00000105270
Original member Current member EBI ENSMUST00000109643.7 ENSMUSP00000105271.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109643.7Link to Ensembl Protein Viewer:ENSMUSP00000105271.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000109643Re-query CCDS DB by Protein ID:ENSMUSP00000105271
Original member Current member EBI ENSMUST00000178855.7 ENSMUSP00000137362.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178855.7Link to Ensembl Protein Viewer:ENSMUSP00000137362.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000178855Re-query CCDS DB by Protein ID:ENSMUSP00000137362
Original member Current member NCBI NM_001109971.1 NP_001103441.1 Accepted alive Link to Nucleotide Sequence:NM_001109971.1Link to Protein Sequence:NP_001103441.1Re-query CCDS DB by Nucleotide ID:NM_001109971Re-query CCDS DB by Protein ID:NP_001103441Link to BLAST:NP_001103441.1
Original member Current member NCBI NM_001109972.1 NP_001103442.1 Accepted alive Link to Nucleotide Sequence:NM_001109972.1Link to Protein Sequence:NP_001103442.1Re-query CCDS DB by Nucleotide ID:NM_001109972Re-query CCDS DB by Protein ID:NP_001103442Link to BLAST:NP_001103442.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103441.1 68 P60060 68 100% 0 0
NP_001103442.1 68 P60060 68 100% 0 0

Chromosomal Locations for CCDS 48755.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 16501798 16501807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 16504736 16504838 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 16506373 16506466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGGATCAGGTAATGCAGTTTGTGGAGCCCAGCCGGCAGTTTGTAAAGGACTCAATTCGGCTGGTTAAAA
GATGCACCAAACCCGACAGAAAAGAATTCCAGAAGATTGCCATGGCTACAGCTATAGGATTTGCTATCAT
GGGATTCATTGGCTTCTTCGTGAAACTGATCCATATACCCATTAATAACATTATTGTGGGTGGCTGA

Translation (68 aa):
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH