NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49306.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49306.1 Public Mus musculus 13 1700001L19Rik 23 108 98 CCDS HistoryNCBI Gene:69315Re-query CCDS DB by CCDS ID:49306.1Re-query CCDS DB by GeneID:69315See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49306.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000022007.7 ENSMUSP00000022007.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022007.7Link to Ensembl Protein Viewer:ENSMUSP00000022007.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000022007Re-query CCDS DB by Protein ID:ENSMUSP00000022007
Original member Current member EBI ENSMUST00000222604.1 ENSMUSP00000152877.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000222604.1Link to Ensembl Protein Viewer:ENSMUSP00000152877.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000222604Re-query CCDS DB by Protein ID:ENSMUSP00000152877
Original member Current member NCBI NM_027035.1 NP_081311.1 Accepted alive Link to Nucleotide Sequence:NM_027035.1Link to Protein Sequence:NP_081311.1Re-query CCDS DB by Nucleotide ID:NM_027035Re-query CCDS DB by Protein ID:NP_081311Link to BLAST:NP_081311.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081311.1 182 Q9DAR0 182 100% 0 0

Chromosomal Locations for CCDS 49306.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 68597476 68597727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68611161 68611277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 68612830 68613009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (549 nt):
ATGGAGGAACTGGCCAAGAAAGAGCGGAGGGCGATGGACCCCGGTGGCTTAAAGAAGGAGGGAAAGGTGG
AA
GAGGAGGCTGGAAAAGAAGAGGGAAGAGAGGAGGAGGGGGGAGAGGAGGAGGAAGTCACCTCCGAAAC
C
CTGCGTGGCAAACCCCGACCTCTGCCCATCTCAGCACTACCAGCTTTCAGCTACATCCCACCAAGGCAC
CAG
GGCCCCAAGGAGCGCAGCTACTTCAGTCGCGAGGGCCAGACAGGGATTGTCTCCCTCTATGACTGTG
TT
TTTAAGAGGAGACTAGATTATAACCAGAAATTACACCGAGATGACAGAGAACATGCAAAGAACCTGGG
G
CTCCATATTAATGAGGAGGAACAAGAAAGGACTGTGCCAGTGCTGATGTCCTCTGTCTATGGGAAACGC
ATC
AATCAGCCCATTGAGCCCCTAAACAGAGACTATGGCCATGTGAGCCACGTGAAGACCGACTTCTACA
GG
AAGAACGAGATCCCCAGCATCAAGGGGCCCGGCTTTGGGCACATCAATCCAGCCTGA


Translation (182 aa):
MEELAKKERRAMDPGGLKKEGKVEEEAGKEEGREEEGGEEEEVTSETLRGKPRPLPISALPAFSYIPPRH
Q
GPKERSYFSREGQ
TGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKR
I
NQPIEPLNRDYGHVSHVKTDFYRKNEIPSIKGPGFGHINPA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser