NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50298.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50298.1 Public Mus musculus 18 Synpo 23 108 98 CCDS HistoryNCBI Gene:104027Re-query CCDS DB by CCDS ID:50298.1Re-query CCDS DB by GeneID:104027See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50298.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000115318.3 ENSMUSP00000110973.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115318.3Link to Ensembl Protein Viewer:ENSMUSP00000110973.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000115318Re-query CCDS DB by Protein ID:ENSMUSP00000110973
Original member Current member EBI ENSMUST00000155195.2 ENSMUSP00000117897.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000155195.2Link to Ensembl Protein Viewer:ENSMUSP00000117897.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000155195Re-query CCDS DB by Protein ID:ENSMUSP00000117897
Original member Current member NCBI NM_001109975.1 NP_001103445.1 Accepted alive Link to Nucleotide Sequence:NM_001109975.1Link to Protein Sequence:NP_001103445.1Re-query CCDS DB by Nucleotide ID:NM_001109975Re-query CCDS DB by Protein ID:NP_001103445Link to BLAST:NP_001103445.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103445.1 690 Q8CC35-3 690 100% 0 0

Chromosomal Locations for CCDS 50298.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 60602083 60604155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2073 nt):
ATGGAGGGGTACTCAGAGGAAGCCAGTCTGCTGCGGCATCTGGAGAAGGTTGCCAGTGAGGAAGAGGAAG
TG
CCATTGGTAGTTTATTTAAAGGAGAATGCAGCCCTGCTGACAGCCAATGGGCTACACCTGTCGCAGAG
C
CGAGAGACCCAGCAGTCCTCACCAAACCCTCCCGACACTGAAGTACCCAGTCCAGCTGCAGATATCAAC
CAG
AACCCGTCCTCACCTAATGCCACACTCACCACACTAGCCTCTAGCAGTCACCACAGTCAGCCCACCG
CT
GATATCAACCAAAACCCTCCAGCCGCCATCACCCCTGTCCCACAGAATTCATCCCAGGCACAGTGCTC
C
CCGAATGGCACACTTGATTCCAAACCCGGCACTCTGTGTGCTGATGATGGGCAGTCCCCGGTGCCGGCA
GAG
GAGGTGAGATCCAGCATTCTCTTGATTGACAAGGTGTCAGCTCCACCTTCTGCCGCCAGCACCTTCT
CT
AGAGAAGCCACGCCCCTCTCCAGCTCTGGGCCGCCAGCGGCAGATCTCATGTCCAGCTCCCTGCTCAT
T
GACATGCAGCCTAGCACCCTAGTGGCACCAGCAGAACAAGAGGTGCCTGGCCATGTAGCTGTCACCACG
CCC
ACTAAGGTGTATAGTGAAGTACATCTCACACTAGCCAAGCCTGCATCCGTGGTCAACAGGACCGCCA
GG
CCTTTTGGGATCCAGTCGCCAGGGACCAGCCAGATAGAGCAAAGCCCCATGATGGGAAGACGACAGTT
T
GGAGAGAAGGCCTGGGCTCCTCCTGCTAGCAGTATGGCGGATAGGAGTCCCCAGCCACAGAGGCACATA
ATG
TCCCGCAGTCCCATGGTGGAAAGGAGACTGCTTGGGCAGCGAAGCCCGGTCCTAGAGAGACGCCCCT
TA
GGAAATTTCACCCCACCCCCCACCTATGCGGAGACTTTGTCAACAGCCCCTGTGGCTTCTCGGGTTAG
G
TCTCCCCCCTCTTACTCCACTCTGTATCCCAGCTCTGACCCCAAGCCTTCCCATTTGAAAGGTCAGGTA
GCC
CCTGCCAACAAGACAGGAATTTTGGAAGAATCTATGGCACGCCGAGGCAGCCGGAAATCAATGTTCA
CT
TTCGTGGAGAAGCCCAAGGTGACCCCGAATCCAGATTTGCTGGACCTAGTGCAGACAGCTGATGAGAA
G
CGGAGGCAGAGAGACCACGGGGAGGTGGGCATGGAAGAAGAGCCCTTTGCCCTGGGAGCTGAGGCCTCC
AAC
TTCCAGCAGGAGCCAATAGCTCGGGACAGGGCCAGCCCTGCGGCAGCTGAGGAAGCTGTCCCTGAGT
GG
GCCTCTTGCCTCAAGTCACCCCGTATCCAGGCCAAGCCGAAGCCCAAACCCAATCAGAACCTCTCGGA
A
GCCTCAGGGAAGGGGGCTGAGCTCTATGCCCGCCGCCAGTCACGGATGGAGAAATACGTCATAGAGTCT
TCA
GGCCATGCCGAATTGGCCCGCTGCCCTTCACCTACCATGTCCCTGCCTTCATCCTGGAAGTACACCA
CT
AACGCCCCTGGGGGCTTCCGAGTGGCATCCTTAAGTCCAGCGCGGACCCCGCCTGCCTCTCTCTACCA
C
GGCTATCTGCCAGAGAATGGAGTCCTGCGCCCTGAACCTACCAAGCAGCAGCCATACCAGATGCGGCCT
TCC
CTCTATGCTCTGTCGCCCGTCAAGGAACCTGCCAAGGCCTCATCGCGTGCCACCTCATCGCGCACTC
CA
TCACGCACTGTCTCACCTCGAGCTGCCTCCCCGGCCAAGCCTAGCTCTCTGGACCTGGTGCCCAACCT
G
CCCAGAGCAGGCCTCCCACCATCTCCTGCTCTGCCTCGGCCTTCCCGCTCCTCCCCAGGCCTCTACACT
GCC
CCAGTCCAAGACAGCCTCCAGCCCACTGCCGTGAGTCCCACTTACAGCAGTGATATCTCCCCCGTGT
CT
CCCTCCAGGGCGTGGTCTCCTCGAGCCAAGCAGGCTCCCAGGCCTTCCTTCTCCACCCGGAATGCTGG
G
ATCGAGGCCCAGGTGTGGAAGCCCTCCTTCTGCTTCAAGTAA


Translation (690 aa):
MEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADIN
Q
NPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQNSSQAQCSPNGTLDSKPGTLCADDGQSPVPA
E
EVRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPGHVAVTT
P
TKVYSEVHLTLAKPASVVNRTARPFGIQSPGTSQIEQSPMMGRRQFGEKAWAPPASSMADRSPQPQRHI
M
SRSPMVERRLLGQRSPVLERRPLGNFTPPPTYAETLSTAPVASRVRSPPSYSTLYPSSDPKPSHLKGQV
A
PANKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEEPFALGAEAS
N
FQQEPIARDRASPAAAEEAVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIES
S
GHAELARCPSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEPTKQQPYQMRP
S
LYALSPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYT
A
PVQDSLQPTAVSPTYSSDISPVSPSRAWSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser